Tested Applications
| Positive WB detected in | HSC-T6 cells, C2C12 cells, NIH/3T3 cells, mouse spleen tissue, mouse brain tissue, rat spleen tissue, RAW 264.7 cells, rat brain tissue |
| Positive IHC detected in | mouse kidney tissue, rat skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 279 publications below |
| IHC | See 13 publications below |
| IF | See 7 publications below |
Product Information
68103-1-Ig targets Bcl2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse, rat samples.
| Tested Reactivity | mouse, rat |
| Cited Reactivity | mouse, rat, pig, chicken, goat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24261 Product name: Recombinant mouse Bcl2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-236 aa of NM-009741 Sequence: MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK Predict reactive species |
| Full Name | B-cell leukemia/lymphoma 2 |
| Calculated Molecular Weight | 26 kDa |
| Observed Molecular Weight | 26 kDa |
| GenBank Accession Number | NM-009741 |
| Gene Symbol | Bcl2 |
| Gene ID (NCBI) | 12043 |
| RRID | AB_2923635 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P10417 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Bcl2 is a member of the B cell lymphoma 2 protein family. Members of this family regulate cell death in multiple cell types and can have either proapoptotic or antiapoptotic activities. The protein encoded by this gene inhibits mitochondrial-mediated apoptosis. This protein is an integral outer mitochondrial membrane protein that functions as part of signaling pathway that controls mitochondrial permeability in response to apoptotic stimuli. This protein may also play a role in neuron cell survival and autophagy. Abnormal expression and chromosomal translocations of this gene are associated with cancer progression in numerous tissues.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Bcl2 antibody 68103-1-Ig | Download protocol |
| IHC protocol for Bcl2 antibody 68103-1-Ig | Download protocol |
| WB protocol for Bcl2 antibody 68103-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cancer hsa_circ_0007919 induces LIG1 transcription by binding to FOXA1/TET1 to enhance the DNA damage response and promote gemcitabine resistance in pancreatic ductal adenocarcinoma | ||
Bioact Mater Chemo-immunotherapy by dual-enzyme responsive peptide self-assembling abolish melanoma | ||
Nucleic Acids Res MEN1 is a regulator of alternative splicing and prevents R-loop-induced genome instability through suppression of RNA polymerase II elongation | ||
Biomaterials Myocardial delivery of miR30d with peptide-functionalized milk-derived extracellular vesicles for targeted treatment of hypertrophic heart failure | ||
Cancer Res PRKDC Induces Chemoresistance in Osteosarcoma by Recruiting GDE2 to Stabilize GNAS and Activate AKT | ||
J Nanobiotechnology Exosome lncRNA IFNG-AS1 derived from mesenchymal stem cells of human adipose ameliorates neurogenesis and ASD-like behavior in BTBR mice |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Amandine (Verified Customer) (02-07-2024) | 20ug of protein denatured or not, primary antibody 1/5000 RT and secondary antibody 1/5000 2h RT. Chemiluminescence revelation with 10min of exposition
![]() |






















