Live Chat

Beclin 1 Fusion Protein

Source

e coli.-derived, PET28a

Tag

6*His

Format

Powder

Cat no : Ag26557

Synonyms

ATG6; VPS30; beclin1

Validation Data Gallery View All

  • Beclin 1 fusion protein Ag26557 SDS-PAGE

    Beclin 1 fusion protein Ag26557 SDS-PAGE

Product Information

Peptide Sequence TDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK
(141-450 aa encoded by BC010276)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Purity85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Formulation The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.

Reconstitution and Storage

Reconstitution Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).
Stability and Storage Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage of Reconstituted Protein Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.