Beta TRCP Polyclonal antibody, PBS Only

Beta TRCP Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 28393-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

28393-1-PBS targets Beta TRCP in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag28739

Product name: Recombinant human BETA-TRCP,BTRC protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 308-605 aa of BC027994

Sequence: CLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR

Predict reactive species
Full Name beta-transducin repeat containing
Calculated Molecular Weight 605 aa, 69 kDa
Observed Molecular Weight 60-65 kDa
GenBank Accession NumberBC027994
Gene Symbol Beta TRCP
Gene ID (NCBI) 8945
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y297
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BTRC, also named as BTRCP, FBW1A, and FBXW1A, is an F-box family protein. It is a Substrate recognition component of an SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. BTRC targets many important proteins with diverse functions, such as p53, HRAS, NF-kappa-B p105 subunit, ATF4, SMAD3, SMAD4, CDC25A, DLG1, FBXO5, and the cell cycle checkpoint protein claspin, for ubiquitin-mediated degradation. It is required for the activation of NFKB-mediated transcription by IL1B, MAP3K14, MAP3K1, IKBKB, and TNF. Required for proteolytic processing of GLI3.

Loading...
||
New chat Able
正在加载,请稍候...