Beta TRCP Polyclonal antibody, PBS Only

• 

  WB analysis using 28393-1-AP (same clone as 28393-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28393-1-AP (Beta TRCP antibody) at dilution of 1:5000 and incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28393-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 28393-1-AP (same clone as 28393-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28393-1-AP (BETA-TRCP,BTRC antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28393-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 28393-1-AP (same clone as 28393-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28393-1-AP (BETA-TRCP,BTRC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28393-1-PBS in a different storage buffer formulation.

Beta TRCP Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28393-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

28393-1-PBS targets Beta TRCP in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28739

  Product name: Recombinant human BETA-TRCP,BTRC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 308-605 aa of BC027994

  Sequence: CLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR

• Full Name: beta-transducin repeat containing
• Calculated Molecular Weight: 605 aa, 69 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC027994
• Gene Symbol: Beta TRCP
• Gene ID (NCBI): 8945
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y297
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BTRC, also named as BTRCP, FBW1A, and FBXW1A, is an F-box family protein. It is a Substrate recognition component of an SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. BTRC targets many important proteins with diverse functions, such as p53, HRAS, NF-kappa-B p105 subunit, ATF4, SMAD3, SMAD4, CDC25A, DLG1, FBXO5, and the cell cycle checkpoint protein claspin, for ubiquitin-mediated degradation. It is required for the activation of NFKB-mediated transcription by IL1B, MAP3K14, MAP3K1, IKBKB, and TNF. Required for proteolytic processing of GLI3.