Beta TRCP Polyclonal antibody

• 

  WB analysis using 28393-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28393-1-AP (Beta TRCP antibody) at dilution of 1:5000 and incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 28393-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28393-1-AP (BETA-TRCP,BTRC antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 28393-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 28393-1-AP (BETA-TRCP,BTRC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Beta TRCP Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28393-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

BTRC, FBXW1A, FBW1A, F-box/WD repeat-containing protein 1A, F-box and WD repeats protein beta-TrCP

---

Tested Applications

• Positive WB detected in: HEK-293T cells, NIH/3T3 cells, U-251 cells, Ramos cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

28393-1-AP targets Beta TRCP in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28739

  Product name: Recombinant human BETA-TRCP,BTRC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 308-605 aa of BC027994

  Sequence: CLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR

• Full Name: beta-transducin repeat containing
• Calculated Molecular Weight: 605 aa, 69 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC027994
• Gene Symbol: Beta TRCP
• Gene ID (NCBI): 8945
• RRID: AB_2935467
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y297
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BTRC, also named as BTRCP, FBW1A, and FBXW1A, is an F-box family protein. It is a Substrate recognition component of an SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. BTRC targets many important proteins with diverse functions, such as p53, HRAS, NF-kappa-B p105 subunit, ATF4, SMAD3, SMAD4, CDC25A, DLG1, FBXO5, and the cell cycle checkpoint protein claspin, for ubiquitin-mediated degradation. It is required for the activation of NFKB-mediated transcription by IL1B, MAP3K14, MAP3K1, IKBKB, and TNF. Required for proteolytic processing of GLI3.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	MedComm (2020); CircMALAT1 promotes cancer stem-like properties and chemoresistance via regulating Musashi-2/c-Myc axis in esophageal squamous cell carcinoma; Authors - Zitong Zhao
mouse	WB	Biochim Biophys Acta Mol Basis Dis; Renal tubular S100A7a impairs fatty acid oxidation and exacerbates renal fibrosis via both intracellular and extracellular pathway; Authors - Pengxiao Sun