Beta Tubulin Polyclonal antibody, PBS Only

• 

  WB analysis using 10063-2-AP (same clone as 10063-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10063-2-AP (Beta Tubulin antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 10063-2-AP (same clone as 10063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 10063-2-AP (Beta Tubulin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 10063-2-AP (same clone as 10063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 10063-2-AP (Beta Tubulin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 10063-2-AP (same clone as 10063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 10063-2-AP (Beta Tubulin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10063-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 10063-2-AP (same clone as 10063-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 10063-2-AP (Beta Tubulin antibody) at dilution of 1:200 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10063-2-PBS in a different storage buffer formulation.

Beta Tubulin Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10063-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Tubulin beta-2B chain, TUBB2B

---

Product Information

10063-2-PBS targets Beta Tubulin in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0108

  Product name: Recombinant human tubulin-beta protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 11-266 aa of BC001352

  Sequence: QCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFF

• Full Name: tubulin, beta 2B
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50kda
• GenBank Accession Number: BC001352
• Gene Symbol: Beta Tubulin
• Gene ID (NCBI): 347733
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BVA1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

There are five tubulins in human cells. They form heterodimers, which multimerize to form a microtubule filament. An alpha and beta tubulin heterodimer is the basic structural unit of microtubules.