Bim Polyclonal antibody, PBS Only

• 

  WB analysis using 22037-1-AP (same clone as 22037-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22037-1-AP (BIM, BCL2L11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22037-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 22037-1-AP (same clone as 22037-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22037-1-AP (BIM, BCL2L11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22037-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 22037-1-AP (same clone as 22037-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22037-1-AP (BIM, BCL2L11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22037-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 22037-1-AP (same clone as 22037-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 22037-1-AP (BIM, BCL2L11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22037-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 22037-1-AP (same clone as 22037-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 22037-1-AP (BIM, BCL2L11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22037-1-PBS in a different storage buffer formulation.

Bim Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 22037-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

22037-1-PBS targets Bim in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11875

  Product name: Recombinant human BIM, BCL2L11 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-198 aa of BC033694

  Sequence: MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH

• Full Name: BCL2-like 11 (apoptosis facilitator)
• Calculated Molecular Weight: 198 aa, 22 kDa
• Observed Molecular Weight: 23 and 18 kDa
• GenBank Accession Number: BC033694
• Gene Symbol: Bim
• Gene ID (NCBI): 10018
• RRID: AB_2878978
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43521
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.