Product Information
16306-1-AP targets OCC1 in IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9286 Product name: Recombinant human C12orf75 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC013920 Sequence: MTQESRACSSVWKEFGSVGRCNVHRHFQGNSKQSPFPFAFPQILSVYIKPWVHIVVVIEGNWLNSTLVYGTFCGHLRKTS Predict reactive species |
| Full Name | chromosome 12 open reading frame 75 |
| Calculated Molecular Weight | 80 aa, 9 kDa |
| GenBank Accession Number | BC013920 |
| Gene Symbol | OCC1 |
| Gene ID (NCBI) | 387882 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TAD7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
OCC1, also named as C12orf75 and AGD3, is a gene whose expression is particularly abundant in neurons in the macaque primary visual cortex (V1).
