C13orf27/TEX30 Polyclonal antibody, PBS Only

• 

  WB analysis of human testis using 25408-1-AP (same clone as 25408-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 25408-1-AP (C13orf27/TEX30 antibody at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25408-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 25408-1-AP (same clone as 25408-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25408-1-AP (C13orf27/TEX30 antibody at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25408-1-PBS in a different storage buffer formulation.

C13orf27/TEX30 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25408-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

25408-1-PBS targets C13orf27/TEX30 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22096

  Product name: Recombinant human C13orf27 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-186 aa of BC015148

  Sequence: MNLPHLMSLASHLASHGFFCLRFTCKGLNIVHRIKAYKSVLNYLKTSGEYKLAGVFLGGRSMGSRAAASVMCHIEPDDGDDFVRGLICISYPLHHPKQQHKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQAPHKIHWIEKANHSMAVKGRSTNDVFKEINTQILFWIQEITEMDKKCH

• Full Name: chromosome 13 open reading frame 27
• Calculated Molecular Weight: 227 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC015148
• Gene Symbol: TEX30
• Gene ID (NCBI): 93081
• RRID: AB_2880064
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JUR7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.