C13orf27/TEX30 Polyclonal antibody

• 

  WB analysis of human testis using 25408-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 25408-1-AP (C13orf27/TEX30 antibody at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 25408-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25408-1-AP (C13orf27/TEX30 antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.

C13orf27/TEX30 Polyclonal Antibody for WB, ELISA

Cat No. 25408-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

C13orf27, TEX30

---

Tested Applications

• Positive WB detected in: human testis tissue, mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25408-1-AP targets C13orf27/TEX30 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22096

  Product name: Recombinant human C13orf27 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-186 aa of BC015148

  Sequence: MNLPHLMSLASHLASHGFFCLRFTCKGLNIVHRIKAYKSVLNYLKTSGEYKLAGVFLGGRSMGSRAAASVMCHIEPDDGDDFVRGLICISYPLHHPKQQHKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQAPHKIHWIEKANHSMAVKGRSTNDVFKEINTQILFWIQEITEMDKKCH

• Full Name: chromosome 13 open reading frame 27
• Calculated Molecular Weight: 227 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC015148
• Gene Symbol: TEX30
• Gene ID (NCBI): 93081
• RRID: AB_2880064
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JUR7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.