Tested Applications
| Positive WB detected in | U2OS cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:150-1:600 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 4 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
27382-1-AP targets C19orf12 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26555 Product name: Recombinant human C19orf12 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-107 aa of BC063518 Sequence: MTIMVEDIMKLLCSLSGERKMKAAVKHSGKGALVTGAMAFVGGLVGGPPGLAVGGAVGGLLGAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRPCSSSCWPCW Predict reactive species |
| Full Name | chromosome 19 open reading frame 12 |
| Calculated Molecular Weight | 107 aa, 11 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC063518 |
| Gene Symbol | C19orf12 |
| Gene ID (NCBI) | 83636 |
| RRID | AB_2880858 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NSK7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for C19orf12 antibody 27382-1-AP | Download protocol |
| WB protocol for C19orf12 antibody 27382-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Free Radic Biol Med C19orf12 ablation causes ferroptosis in mitochondrial membrane protein-associated with neurodegeneration. | ||
Stem Cell Res Generation of four human induced pluripotent stem cell lines derived from patients with MPAN, subtype of NBIA, carrying the c.204_214del11 mutation in the C19orf12 gene | ||
Cell Rep C19orf12 inhibits mitochondrial function and enhances the antitumor effects of metformin in non-small cell lung cancer
|





