Tested Applications
| Positive WB detected in | U2OS cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:150-1:600 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
Product Information
27382-1-AP targets C19orf12 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26555 Product name: Recombinant human C19orf12 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-107 aa of BC063518 Sequence: MTIMVEDIMKLLCSLSGERKMKAAVKHSGKGALVTGAMAFVGGLVGGPPGLAVGGAVGGLLGAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRPCSSSCWPCW Predict reactive species |
| Full Name | chromosome 19 open reading frame 12 |
| Calculated Molecular Weight | 107 aa, 11 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC063518 |
| Gene Symbol | C19orf12 |
| Gene ID (NCBI) | 83636 |
| RRID | AB_2880858 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NSK7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The C19orf12 protein is a mitochondrial membrane protein encoded by the C19orf12 gene, containing a glycine zipper domain and localized to the outer mitochondrial membrane or the mitochondria-associated membrane (MAM). This protein is closely associated with mitochondrial membrane protein-associated neurodegenerative disorders (MPAN), and mutations in its gene lead to mitochondrial dysfunction, ferroptosis, and neurodegeneration. Research indicates that C19orf12 participates in regulating mitochondrial calcium homeostasis, oxidative stress responses, mitochondrial autophagy, and reactive oxygen species (ROS) balance. While its precise biological functions remain incompletely elucidated, its critical role in maintaining mitochondrial homeostasis and cellular survival is widely recognized.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for C19orf12 antibody 27382-1-AP | Download protocol |
| WB protocol for C19orf12 antibody 27382-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Free Radic Biol Med C19orf12 ablation causes ferroptosis in mitochondrial membrane protein-associated with neurodegeneration. | ||
Cell Rep C19orf12 inhibits mitochondrial function and enhances the antitumor effects of metformin in non-small cell lung cancer | ||
Stem Cell Res Generation of four human induced pluripotent stem cell lines derived from patients with MPAN, subtype of NBIA, carrying the c.204_214del11 mutation in the C19orf12 gene | ||
