C1QL2 Polyclonal antibody

• 

  WB analysis using 32206-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32206-1-AP (C1QL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat brain using 32206-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 32206-1-AP (C1QL2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 32206-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 32206-1-AP (C1QL2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

C1QL2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 32206-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

C1q and tumor necrosis factor-related protein 10, C1q/TNF-related protein 10, Complement C1q-like protein 2, CTRP10

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: rat brain tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32206-1-AP targets C1QL2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37614

  Product name: Recombinant human C1QL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-80 aa of NM_182528

  Sequence: HYEMMGTCRMICDPYTAAPGGEPPGAKAQPPGPSTAALEVMQDLSANPPPPFIQGPKGD

• Full Name: complement component 1, q subcomponent-like 2
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: NM_182528
• Gene Symbol: C1QL2
• Gene ID (NCBI): 165257
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z5L3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Complement C1q-like protein 2 (C1QL2, also known as CTRP10) is a member of the C1q-like protein family. It is a secreted protein that plays a role in synaptic organization and function. C1QL2 is involved in the formation and maintenance of synapses, particularly in the central nervous system (CNS) (PMID: 20646056). It interacts with specific neurexin-3 isoforms to recruit synaptic vesicles and modulate synaptic transmission. Additionally, C1QL2 has been implicated in the regulation of hippocampal mossy fiber-CA3 synapse function, suggesting its role in synaptic plasticity and memory formation (PMID: 28219683).