COA6 Polyclonal antibody

• 

  WB analysis of HEK-293 using 24209-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24209-1-AP (COA6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 24209-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 24209-1-AP (COA6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 24209-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24209-1-AP (COA6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 24209-1-AP

  IP result of anti-COA6 (IP:24209-1-AP, 4ug; Detection:24209-1-AP 1:500) with HEK-293 cells lysate 1760ug.

• 

  IHC staining of human kidney using 24209-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24209-1-AP (COA6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 24209-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24209-1-AP (COA6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 24209-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using C1orf31 antibody (24209-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

COA6 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 24209-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, ELISA

Synonyms

C1orf31

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse liver tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 4 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

24209-1-AP targets COA6 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21525

  Product name: Recombinant human C1orf31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 47-125 aa of BC116455

  Sequence: MAAPSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTAKS

• Full Name: chromosome 1 open reading frame 31
• Calculated Molecular Weight: 125 aa, 14 kDa
• Observed Molecular Weight: 10 - 18 kDa
• GenBank Accession Number: BC116455
• Gene Symbol: COA6
• Gene ID (NCBI): 388753
• RRID: AB_2879459
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q5JTJ3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C1orf31, also known as COA6, is a conserved mitochondrial protein required for respiratory complex IV biogenesis. Recently study reported that C1orf31 is required for maintenance of cytochrome c oxidase (CcO) subunit levels, and has role in the Cu delivery pathway to CcO. Defects in C1orf31 is associated with mitochondrial respiratory chain disease (MRCD). (24549041)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Hum Mol Genet; Copper supplementation restores cytochrome c oxidase assembly defect in a mitochondrial disease model of COA6 deficiency.; Authors - Alok Ghosh ; KD Validated
human	WB	Cell Rep; COA6 Is Structurally Tuned to Function as a Thiol-Disulfide Oxidoreductase in Copper Delivery to Mitochondrial Cytochrome c Oxidase.; Authors - Shivatheja Soma
human	IHC	Heliyon; Prognostic value and immunological function of cuproptosis-related genes in lung adenocarcinoma; Authors - Liming Zhang
human	WB	Sci Rep; Oxidative phosphorylation related gene COA6 is a novel indicator for the prognosis and immune response in lung adenocarcinoma; Authors - Wenting Liu
human	WB,IF	Int J Mol Sci; High Expression of COA6 Is Related to Unfavorable Prognosis and Enhanced Oxidative Phosphorylation in Lung Adenocarcinoma; Authors - Ming Zhang ; KD Validated