Tested Applications
| Positive WB detected in | HEK-293 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24209-1-AP targets COA6 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21525 Product name: Recombinant human C1orf31 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 47-125 aa of BC116455 Sequence: MAAPSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTAKS Predict reactive species |
| Full Name | chromosome 1 open reading frame 31 |
| Calculated Molecular Weight | 125 aa, 14 kDa |
| Observed Molecular Weight | 10 - 18 kDa |
| GenBank Accession Number | BC116455 |
| Gene Symbol | COA6 |
| Gene ID (NCBI) | 388753 |
| RRID | AB_2879459 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q5JTJ3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C1orf31, also known as COA6, is a conserved mitochondrial protein required for respiratory complex IV biogenesis. Recently study reported that C1orf31 is required for maintenance of cytochrome c oxidase (CcO) subunit levels, and has role in the Cu delivery pathway to CcO. Defects in C1orf31 is associated with mitochondrial respiratory chain disease (MRCD). (24549041)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for COA6 antibody 24209-1-AP | Download protocol |
| IHC protocol for COA6 antibody 24209-1-AP | Download protocol |
| IP protocol for COA6 antibody 24209-1-AP | Download protocol |
| WB protocol for COA6 antibody 24209-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The COA6 antibody (Cat# 24209-1-AP) has 7 citations published in journals including Translational Neurodegeneration, Cell Reports, International Journal of Molecular Sciences, Scientific Reports, Biochimica et Biophysica Acta Molecular Cell Research, Human Molecular Genetics, and Heliyon. Research fields span mitochondrial dysfunction, copper delivery to cytochrome c oxidase, oxidative phosphorylation, lung adenocarcinoma prognosis, hepatocellular carcinoma, cuproptosis, and cytochrome c oxidase assembly in mitochondrial disease models.
| Species | Application | Title |
|---|---|---|
Transl Neurodegener The Drp1-CoQ10-Coa6-ETC axis represents a therapeutic potential for working memory impairment caused by neuronal mitochondrial dysfunction.
| ||
Cell Rep COA6 Is Structurally Tuned to Function as a Thiol-Disulfide Oxidoreductase in Copper Delivery to Mitochondrial Cytochrome c Oxidase. | ||
Int J Mol Sci High Expression of COA6 Is Related to Unfavorable Prognosis and Enhanced Oxidative Phosphorylation in Lung Adenocarcinoma
| ||
Sci Rep Oxidative phosphorylation related gene COA6 is a novel indicator for the prognosis and immune response in lung adenocarcinoma | ||
Biochim Biophys Acta Mol Cell Res COA6 deficiency inhibits hepatocellular carcinoma progression by regulating cuproptosis through the JAK/STAT signaling pathway | ||
Hum Mol Genet Copper supplementation restores cytochrome c oxidase assembly defect in a mitochondrial disease model of COA6 deficiency.
|
