Tested Applications
Positive WB detected in | HEK-293 cells, mouse liver tissue |
Positive IP detected in | HEK-293 cells |
Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 4 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
24209-1-AP targets COA6 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21525 Product name: Recombinant human C1orf31 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 47-125 aa of BC116455 Sequence: MAAPSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTAKS Predict reactive species |
Full Name | chromosome 1 open reading frame 31 |
Calculated Molecular Weight | 125 aa, 14 kDa |
Observed Molecular Weight | 10 - 18 kDa |
GenBank Accession Number | BC116455 |
Gene Symbol | COA6 |
Gene ID (NCBI) | 388753 |
RRID | AB_2879459 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | Q5JTJ3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C1orf31, also known as COA6, is a conserved mitochondrial protein required for respiratory complex IV biogenesis. Recently study reported that C1orf31 is required for maintenance of cytochrome c oxidase (CcO) subunit levels, and has role in the Cu delivery pathway to CcO. Defects in C1orf31 is associated with mitochondrial respiratory chain disease (MRCD). (24549041)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for COA6 antibody 24209-1-AP | Download protocol |
IHC protocol for COA6 antibody 24209-1-AP | Download protocol |
IF protocol for COA6 antibody 24209-1-AP | Download protocol |
IP protocol for COA6 antibody 24209-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Hum Mol Genet Copper supplementation restores cytochrome c oxidase assembly defect in a mitochondrial disease model of COA6 deficiency.
| ||
Cell Rep COA6 Is Structurally Tuned to Function as a Thiol-Disulfide Oxidoreductase in Copper Delivery to Mitochondrial Cytochrome c Oxidase. | ||
Int J Mol Sci High Expression of COA6 Is Related to Unfavorable Prognosis and Enhanced Oxidative Phosphorylation in Lung Adenocarcinoma
| ||
Heliyon Prognostic value and immunological function of cuproptosis-related genes in lung adenocarcinoma | ||
Sci Rep Oxidative phosphorylation related gene COA6 is a novel indicator for the prognosis and immune response in lung adenocarcinoma |