Tested Applications
Positive WB detected in | MCF-7 cells, mouse pancreas tissue |
Positive IHC detected in | human colon cancer tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | U2OS cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 8 publications below |
IHC | See 4 publications below |
IF | See 2 publications below |
Product Information
19912-1-AP targets PPDPF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13740 Product name: Recombinant human C20orf149 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC002531 Sequence: MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLPFMATVLESAEHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS Predict reactive species |
Full Name | chromosome 20 open reading frame 149 |
Calculated Molecular Weight | 114 aa, 12 kDa |
Observed Molecular Weight | 10-12 kDa |
GenBank Accession Number | BC002531 |
Gene Symbol | PPDPF |
Gene ID (NCBI) | 79144 |
RRID | AB_10642438 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9H3Y8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Pancreatic progenitor cell differentiation and proliferation factor (PPDPF), also known as C20orf149 and EXPDF, belongs to the PPDPF family. PPDPF is a key regulator for the development of exocrine pancreas. PPDPF is highly expressed in various cancers, including HCC, colorectal cancer, prostate cancer, etc (PMID: 34031390, 34975328, 37027301). PPDPF consists of 114 amino acids and the molecular weight is 12 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for PPDPF antibody 19912-1-AP | Download protocol |
IHC protocol for PPDPF antibody 19912-1-AP | Download protocol |
IF protocol for PPDPF antibody 19912-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Metab Quantitative high-confidence human mitochondrial proteome and its dynamics in cellular context. | ||
Cell Rep PPDPF suppresses the development of hepatocellular carcinoma through TRIM21-mediated ubiquitination of RIPK1 | ||
Int J Biol Sci PPDPF Promotes the Progression and acts as an Antiapoptotic Protein in Non-Small Cell Lung Cancer. | ||
Front Oncol The Exocrine Differentiation and Proliferation Factor (EXDPF) Gene Promotes Ovarian Cancer Tumorigenesis by Up-Regulating DNA Replication Pathway. | ||
Medicine (Baltimore) Pancreatic progenitor cell differentiation and proliferation factor predicts poor prognosis in heptaocellular carcinoma. | ||
EMBO Rep Phosphorylation of PPDPF via IL6-JAK2 activates the Wnt/β-catenin pathway in colorectal cancer |