Tested Applications
| Positive WB detected in | MCF-7 cells, mouse pancreas tissue |
| Positive IHC detected in | human colon cancer tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 8 publications below |
| IHC | See 4 publications below |
| IF | See 2 publications below |
Product Information
19912-1-AP targets PPDPF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13740 Product name: Recombinant human C20orf149 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC002531 Sequence: MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLPFMATVLESAEHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS Predict reactive species |
| Full Name | chromosome 20 open reading frame 149 |
| Calculated Molecular Weight | 114 aa, 12 kDa |
| Observed Molecular Weight | 10-12 kDa |
| GenBank Accession Number | BC002531 |
| Gene Symbol | PPDPF |
| Gene ID (NCBI) | 79144 |
| RRID | AB_10642438 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H3Y8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Pancreatic progenitor cell differentiation and proliferation factor (PPDPF), also known as C20orf149 and EXPDF, belongs to the PPDPF family. PPDPF is a key regulator for the development of exocrine pancreas. PPDPF is highly expressed in various cancers, including HCC, colorectal cancer, prostate cancer, etc (PMID: 34031390, 34975328, 37027301). PPDPF consists of 114 amino acids and the molecular weight is 12 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PPDPF antibody 19912-1-AP | Download protocol |
| IHC protocol for PPDPF antibody 19912-1-AP | Download protocol |
| WB protocol for PPDPF antibody 19912-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab Quantitative high-confidence human mitochondrial proteome and its dynamics in cellular context. | ||
Cell Rep PPDPF suppresses the development of hepatocellular carcinoma through TRIM21-mediated ubiquitination of RIPK1 | ||
Int J Biol Sci PPDPF Promotes the Progression and acts as an Antiapoptotic Protein in Non-Small Cell Lung Cancer. | ||
Front Oncol The Exocrine Differentiation and Proliferation Factor (EXDPF) Gene Promotes Ovarian Cancer Tumorigenesis by Up-Regulating DNA Replication Pathway. | ||
Sci Adv PPDPF preserves integrity of proximal tubule by modulating NMNAT activity in chronic kidney diseases | ||
Medicine (Baltimore) Pancreatic progenitor cell differentiation and proliferation factor predicts poor prognosis in heptaocellular carcinoma. |











