PPDPF Polyclonal antibody

• 

  WB analysis using 19912-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19912-1-AP (PPDPF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 19912-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 19912-1-AP (PPDPF antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 19912-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 19912-1-AP (C20orf149 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas using 19912-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 19912-1-AP (PPDPF antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human pancreas using 19912-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 19912-1-AP (PPDPF antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of U2OS using 19912-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using PPDPF antibody (19912-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

PPDPF Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 19912-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

C20orf149, EXPDF

---

Tested Applications

• Positive WB detected in: MCF-7 cells, mouse pancreas tissue
• Positive IHC detected in: human colon cancer tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 8 publications below
• IHC: See 4 publications below
• IF: See 2 publications below

Product Information

19912-1-AP targets PPDPF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13740

  Product name: Recombinant human C20orf149 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-114 aa of BC002531

  Sequence: MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLPFMATVLESAEHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS

• Full Name: chromosome 20 open reading frame 149
• Calculated Molecular Weight: 114 aa, 12 kDa
• Observed Molecular Weight: 10-12 kDa
• GenBank Accession Number: BC002531
• Gene Symbol: PPDPF
• Gene ID (NCBI): 79144
• RRID: AB_10642438
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H3Y8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pancreatic progenitor cell differentiation and proliferation factor (PPDPF), also known as C20orf149 and EXPDF, belongs to the PPDPF family. PPDPF is a key regulator for the development of exocrine pancreas. PPDPF is highly expressed in various cancers, including HCC, colorectal cancer, prostate cancer, etc (PMID: 34031390, 34975328, 37027301). PPDPF consists of 114 amino acids and the molecular weight is 12 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Metab; Quantitative high-confidence human mitochondrial proteome and its dynamics in cellular context.; Authors - Marcel Morgenstern
mouse,human	WB,IHC	Cell Rep; PPDPF suppresses the development of hepatocellular carcinoma through TRIM21-mediated ubiquitination of RIPK1; Authors - Yi-Kang Wang
human	WB	Int J Biol Sci; PPDPF Promotes the Progression and acts as an Antiapoptotic Protein in Non-Small Cell Lung Cancer.; Authors - Mu Yun
human	WB	Front Oncol; The Exocrine Differentiation and Proliferation Factor (EXDPF) Gene Promotes Ovarian Cancer Tumorigenesis by Up-Regulating DNA Replication Pathway.; Authors - Yangjiong Xiao
human	WB,IHC	Medicine (Baltimore); Pancreatic progenitor cell differentiation and proliferation factor predicts poor prognosis in heptaocellular carcinoma.; Authors - Zhengfa Mao
human	WB,IHC,IF	EMBO Rep; Phosphorylation of PPDPF via IL6-JAK2 activates the Wnt/β-catenin pathway in colorectal cancer; Authors - Yuyuan Zi