Tested Applications
Positive IHC detected in | mouse testis tissue, rat testis tissue, human small intestine tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IF | See 2 publications below |
Product Information
24867-1-AP targets C22orf41 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21756 Product name: Recombinant human C22orf41 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC127859 Sequence: MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQRL Predict reactive species |
Full Name | chromosome 22 open reading frame 41 |
Calculated Molecular Weight | 88 aa, 11 kDa |
GenBank Accession Number | BC127859 |
Gene Symbol | C22orf41 |
Gene ID (NCBI) | 644186 |
RRID | AB_2879765 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | A1L190 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C22orf41 is also named as SYCE3 and THEG2. C22orf41 is major component of the transverse central element of synaptonemal complexes (SCS). It formed between homologous chromosomes during meiotic prophase. SYCE3 is a small protein of 88 amino acids that is essential for SC assembly, meiotic division, and fertility (PMID:21637789).
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for C22orf41 antibody 24867-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Steroid Biochem Mol Biol Syce1 and Syce3 regulate testosterone and dihydrotestosterone synthesis via steroidogenic pathways in mouse Sertoli and Leydig cells. | ||