C2orf47 Polyclonal antibody

• 

  WB analysis of mouse kidney using 24930-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 24930-1-AP (C2orf47 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 24930-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 24930-1-AP (C2orf47 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 24930-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 24930-1-AP (C2orf47 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 24930-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24930-1-AP (C2orf47 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 24930-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24930-1-AP (C2orf47 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

C2orf47 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24930-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

m-AAA protease-interacting protein 1, mitochondrial, MAIP1, Matrix AAA peptidase-interacting protein 1

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, HeLa cells, PC-3 cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

24930-1-AP targets C2orf47 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21518

  Product name: Recombinant human C2orf47 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-291 aa of BC017959

  Sequence: MALAARLLPQFLHSRSLPCGAVRLRTPAVAEVRLPSATLCYFCRCRLGLGAALFPRSARALAASALPAQGSRWPVLSSPGLPAAFASFPACPQRSYSTEEKPQQHQKTKMIVLGFSNPINWVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIVFTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETLRGASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE

• Full Name: chromosome 2 open reading frame 47
• Calculated Molecular Weight: 291 aa, 33 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC017959
• Gene Symbol: C2orf47
• Gene ID (NCBI): 79568
• RRID: AB_2879804
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WWC4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C2orf47, also named matrix AAA peptidase interacting protein 1 (MAIP1), is a 291 amino-acid protein that localizes in the Mitochondrion. C2orf47 is involved in protecting EMRE, a component of the single calcium complex (MCU), from proteolysis by assisting membrane insertion.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Nat Cell Biol; Small heat shock proteins operate as molecular chaperones in the mitochondrial intermembrane space; Authors - Elias Adriaenssens