C2orf47 Polyclonal antibody

C2orf47 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 24930-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

m-AAA protease-interacting protein 1, mitochondrial, MAIP1, Matrix AAA peptidase-interacting protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, HeLa cells, PC-3 cells
Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

24930-1-AP targets C2orf47 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21518

Product name: Recombinant human C2orf47 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-291 aa of BC017959

Sequence: MALAARLLPQFLHSRSLPCGAVRLRTPAVAEVRLPSATLCYFCRCRLGLGAALFPRSARALAASALPAQGSRWPVLSSPGLPAAFASFPACPQRSYSTEEKPQQHQKTKMIVLGFSNPINWVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIVFTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETLRGASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE

Predict reactive species
Full Name chromosome 2 open reading frame 47
Calculated Molecular Weight 291 aa, 33 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC017959
Gene Symbol C2orf47
Gene ID (NCBI) 79568
RRIDAB_2879804
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WWC4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C2orf47, also named matrix AAA peptidase interacting protein 1 (MAIP1), is a 291 amino-acid protein that localizes in the Mitochondrion. C2orf47 is involved in protecting EMRE, a component of the single calcium complex (MCU), from proteolysis by assisting membrane insertion.

Protocols

Product Specific Protocols
IHC protocol for C2orf47 antibody 24930-1-APDownload protocol
WB protocol for C2orf47 antibody 24930-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB

Nat Cell Biol

Small heat shock proteins operate as molecular chaperones in the mitochondrial intermembrane space

Authors - Elias Adriaenssens
Loading...
||
New chat Able
正在加载,请稍候...