C2orf7 Polyclonal antibody

• 

  WB analysis using 20616-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20616-1-AP (C2orf7 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 20616-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20616-1-AP (C2orf7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

C2orf7 Polyclonal Antibody for WB, ELISA

Cat No. 20616-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C2orf7, hPAP21, PAP21, PRADC1

---

Tested Applications

• Positive WB detected in: human plasma, human serum

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20616-1-AP targets C2orf7 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14678

  Product name: Recombinant human C2orf7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-188 aa of BC005069

  Sequence: MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW

• Full Name: chromosome 2 open reading frame 7
• Calculated Molecular Weight: 188 aa, 21 kDa
• Observed Molecular Weight: 21-30 kDa
• GenBank Accession Number: BC005069
• Gene Symbol: C2orf7
• Gene ID (NCBI): 84279
• RRID: AB_3085609
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BSG0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protease-associated domain-containing 1 (PRADC1), also known as C2orf7, is an enigmatic secretory protein widely expressed in humans and mice. C2orf7 is a ∼30-kDa N-glycosylated secretory protein with a protease-associated domain (PMID: 31689374).