• Featured Product
  • KD/KO Validated

C3/C3b/C3c Polyclonal antibody

C3/C3b/C3c Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 21337-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (4)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA

C3, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1, Complement C3, Complement component C3, CPAMD1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat plasma, human plasma
Positive IP detected inhuman plasma tissue
Positive IHC detected inhuman liver tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman liver cancer tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21337-1-AP targets C3/C3b/C3c in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, mouse, rat, pig, monkey, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15537

Product name: Recombinant human C3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1314-1663 aa of BC150179

Sequence: ESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN

Predict reactive species
Full Name complement component 3
Calculated Molecular Weight 1663 aa, 187 kDa
Observed Molecular Weight 115 kDa
GenBank Accession NumberBC150179
Gene Symbol C3
Gene ID (NCBI) 718
RRIDAB_2878843
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01024
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The complement system is an important effector that bridges the innate and adaptive immune systems (PMID: 20010915). The third component of complement, C3, plays a central role in activating the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways (PMID: 11414361). Human C3 (190-195 kDa), composed of α and β chains (115-120 and 75 kDa, respectively), is cleaved into C3a and C3b by C3 convertase. C3b is composed of the α' chain and β chain (PMID: 27210597). Factor I cleaves the α′ chain of C3b to 68 kDa and 43 kDa degradation products (iC3b) (PMID: 25395424; 14527961). This antibody raised against 1314-1663 aa of human C3 protein recognizes the C3 α chain (115-120 kDa), C3b α' chain (110-115 kDa), and C3c α' chain fragment 2 (43 kDa).

Protocols

Product Specific Protocols
IF protocol for C3/C3b/C3c antibody 21337-1-APDownload protocol
IHC protocol for C3/C3b/C3c antibody 21337-1-APDownload protocol
IP protocol for C3/C3b/C3c antibody 21337-1-APDownload protocol
WB protocol for C3/C3b/C3c antibody 21337-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nat Cell Biol

Autophagy enables microglia to engage amyloid plaques and prevents microglial senescence

Authors - Insup Choi
mouseWB

Brain Behav Immun

PDE4 inhibition alleviates HMGB1/C1q/C3-mediated excessive phagocytic pruning of synapses by microglia and depressive-like behaviors in mice

Authors - Qian Zhao
mouse

Neuron

C5aR1+ microglia exacerbate neuroinflammation and cerebral edema in acute brain injury

Authors - Jinpeng Zhou

Brain

Extracellular vesicle biomarkers for complement dysfunction in schizophrenia

Authors - Ting Xue
IF

J Autoimmun

TIGIT-Fc fusion protein alleviates murine lupus nephritis through the regulation of SPI-B-PAX5-XBP1 axis-mediated B-cell differentiation

Authors - Junpeng Zhao
mouseIHC,IF

Gut Microbes

Targeted modulation of intestinal barrier and mucosal immune-related microbiota attenuates IgA nephropathy progression

Authors - Ran Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Boyan (Verified Customer) (08-27-2025)

good for WB, two bands at ~190 and 130 kd, both of which are C3 forms

  • Applications: Western Blot
  • Cell Tissue Type: human
FH

Marisa (Verified Customer) (07-31-2025)

We used the C3/C3b/C3c antibody in immunofluorescence and obtained a detectable signal, though some background was present. With slight optimization, it worked for visualizing complement activation by confocal microscopy.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/100
  • Cell Tissue Type: Brain
C3/C3b/C3c Antibody Immunofluorescence validation (1/100 dilution) in Brain (Cat no:21337-1-AP)
FH

Marion (Verified Customer) (08-01-2024)

LPS induction model Fixative : Paraformaldehyde 4% Permeabilization: 10 min; RT; 0.2% Triton X-100 Blocking: 2 h; RT; 10% Normal donkey serum; 1% BSA Primary antibody: 1 night; 4°C Secondary antibody: ab150064 (Abcam); 1h30; RT Antibodies diluted in blocking solution

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/200
  • Cell Tissue Type: Rat Kidney
C3/C3b/C3c Antibody Immunofluorescence validation (1/200 dilution) in Rat Kidney (Cat no:21337-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...