C4orf26 Polyclonal antibody

• 

  IHC staining of human placenta using 30132-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30132-1-AP (C4orf26 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 30132-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30132-1-AP (C4orf26 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

C4orf26 Polyclonal Antibody for IHC, ELISA

Cat No. 30132-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

ODAPH, FLJ23657

---

Tested Applications

• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30132-1-AP targets C4orf26 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32600

  Product name: Recombinant human C4orf26 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-130 aa of NM_001206981

  Sequence: QEEVFTPPGDSQNNADATDCQIFTLTPPPAPRSPVTRAQPITKTPRCPFHFFPRRPRIHFRFPNRPFVPSRCNHRFPFQPFYWPHRYLTYRYFPRRRLQRGSSSEES

• Full Name: chromosome 4 open reading frame 26
• Calculated Molecular Weight: 16kd
• GenBank Accession Number: NM_001206981
• Gene Symbol: C4orf26
• Gene ID (NCBI): 152816
• RRID: AB_3086240
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q17RF5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Chromosome 4 open reading frame 26 (C4orf26), also known as odontogenesis associated phosphoprotein (ODAPH), is an enamel matrix protein at the maturation stage. It has been reported that mutations in C4orf26 gene are associated with autosomal recessive type of Amelogenesis Imperfecta (AI), a hereditary condition that affects enamel formation/mineralization (PMID: 33884476; PMID: 36163390).