ABHD18 Polyclonal antibody

• 

  WB analysis of PC-3 using 25036-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25036-1-AP (C4orf29 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 25036-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 25036-1-AP (C4orf29 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 25036-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 25036-1-AP (C4orf29 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 25036-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 25036-1-AP (C4orf29 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 25036-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 25036-1-AP (C4orf29 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 25036-1-AP

  Immunofluorescent analysis of A549 cells using 25036-1-AP (C4orf29 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of A549 using 25036-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using C4orf29 antibody (25036-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

ABHD18 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25036-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

C4orf29, Abhydrolase domain-containing protein 18, Alpha/beta hydrolase domain-containing protein 18, Protein ABHD18

---

Tested Applications

• Positive WB detected in: PC-3 cells, A549 cells, mouse heart tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25036-1-AP targets ABHD18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19120

  Product name: Recombinant human C4orf29 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 209-332 aa of BC128143

  Sequence: TSEGLLLQDTSKMKRFNQTLSTNKSGYTSRNPQSYHLLSKEQSRNSLRKESLIFMKGVMDECTHVANFSVPVDPSLIIVVQAKEDAYIPRTGVRSLQEIWPGCEIRYLEGGHISAYLFKQGLFR

• Full Name: chromosome 4 open reading frame 29
• Calculated Molecular Weight: 414 aa, 47 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC128143
• Gene Symbol: C4orf29
• Gene ID (NCBI): 80167
• RRID: AB_2879862
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q0P651
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ABHD18 (α/β hydrolase domain-containing protein 18) is a transmembrane protein in mammals whose function has not yet been fully elucidated. It belongs to the large α/β hydrolase superfamily, whose members typically possess hydrolase activity and are involved in a variety of metabolic reactions. The ABHD18 protein is localized on the lysosomal membrane and may participate in intracellular lipid metabolism or signal transduction processes. Recent studies have shown that ABHD18 is the key enzyme in human cells that catalyzes the deacylation of cardiolipin to MLCL. The loss of ABHD18 function can significantly alleviate mitochondrial supercomplex defects, energy metabolism disorders, and cardiomyopathy phenotypes caused by TAZ deficiency, even achieving a "genetic suppression" effect in mice and patient cells. This not only reveals ABHD18 as a core node in the cardiolipin remodeling pathway but also provides an entirely new therapeutic approach for mitochondrial diseases such as Barth syndrome.