C5 Polyclonal antibody, PBS Only

C5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 22492-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

C5, C5a, C5, C5b, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4, C5a anaphylatoxin, Complement C5

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

22492-1-PBS targets C5 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17882

Product name: Recombinant human C5, C5a protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1418-1676 aa of BC113740

Sequence: GSSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

Predict reactive species
Full Name complement component 5
Calculated Molecular Weight 1676 aa, 188 kDa
Observed Molecular Weight120 kDa, 70 kDa
GenBank Accession NumberBC113740
Gene Symbol C5
Gene ID (NCBI) 727
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDP01031
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The complement system is an important effector that bridges the innate and adaptive immune systems. The fifth component of complement, C5, is part of the complement cascade and plays an important role in inflammation and cell killing. It consists of disulfide-linked alpha and beta polypeptide chains but can be cleaved into two active peptides (C5a and C5b) by C5 convertases. Mutations and defects in C5 are associated with severe recurrent infections. (PMID: 20010915; PMID: 8011297; PMID: 6554279)

Loading...