C5 Polyclonal antibody, PBS Only

• 

  WB analysis using 22492-1-AP (same clone as 22492-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22492-1-AP (C5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22492-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 22492-1-AP (same clone as 22492-1-PBS)

  rat plasma was subjected to SDS PAGE followed by western blot with 22492-1-AP (C5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22492-1-PBS in a different storage buffer formulation.

C5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 22492-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

C5, C5a, C5, C5b, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4, C5a anaphylatoxin, Complement C5

---

Product Information

22492-1-PBS targets C5 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17882

  Product name: Recombinant human C5, C5a protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1418-1676 aa of BC113740

  Sequence: GSSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

• Full Name: complement component 5
• Calculated Molecular Weight: 1676 aa, 188 kDa
• Observed Molecular Weight: 120 kDa, 70 kDa
• GenBank Accession Number: BC113740
• Gene Symbol: C5
• Gene ID (NCBI): 727
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P01031
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The complement system is an important effector that bridges the innate and adaptive immune systems. The fifth component of complement, C5, is part of the complement cascade and plays an important role in inflammation and cell killing. It consists of disulfide-linked alpha and beta polypeptide chains but can be cleaved into two active peptides (C5a and C5b) by C5 convertases. Mutations and defects in C5 are associated with severe recurrent infections. (PMID: 20010915; PMID: 8011297; PMID: 6554279)