Product Information
60761-1-PBS targets C5AR1 as part of a matched antibody pair:
MP51210-1: 60761-1-PBS capture and 60761-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29140 Product name: Recombinant human C5AR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC008982 Sequence: MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTI Predict reactive species |
Full Name | complement component 5a receptor 1 |
Calculated Molecular Weight | 350 aa, 39 kDa |
GenBank Accession Number | BC008982 |
Gene Symbol | C5aR |
Gene ID (NCBI) | 728 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G Magarose purification |
UNIPROT ID | P21730 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |