Product Information
84336-4-PBS targets C5AR1/CD88 as part of a matched antibody pair:
MP01255-4: 84336-8-PBS capture and 84336-4-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg2185 Product name: Recombinant Human C5AR1/CD88 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-37 aa of NM_001736.4 Sequence: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPD Predict reactive species |
Full Name | complement component 5a receptor 1 |
Calculated Molecular Weight | 39kDa |
GenBank Accession Number | NM_001736.4 |
Gene Symbol | C5aR |
Gene ID (NCBI) | 728 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P21730 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |