C5AR1/CD88 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP01255-4

  Sandwich ELISA standard curve of MP01255-4, Human C5AR1/CD88 Recombinant Matched Antibody Pair - PBS only. 84336-8-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg2185. 84336-4-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL.

• 

  Sample test of MP01255-4

  The mean C5AR1/CD88 concentration was determined to be 388.97 ng/mL in U-937 cell extract based on a 2.20 mg/mL extract load and 103.14 ng/mL in L02 cell extract based on a 1.30 mg/mL extract load.

C5AR1/CD88 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84336-4-PBS

Clone No.241712A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

C5AR, C5AR1, C5A, C5a anaphylatoxin chemotactic receptor 1, C5a R

---

Product Information

84336-4-PBS targets C5AR1/CD88 as part of a matched antibody pair:

MP01255-4: 84336-8-PBS capture and 84336-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2185

  Product name: Recombinant Human C5AR1/CD88 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 1-37 aa of NM_001736.4

  Sequence: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPD

• Full Name: complement component 5a receptor 1
• Calculated Molecular Weight: 39kDa
• GenBank Accession Number: NM_001736.4
• Gene Symbol: C5aR
• Gene ID (NCBI): 728
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21730
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.