Tested Applications
Positive WB detected in | U-937 cells, U-87 MG cells |
Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
84336-6-RR targets C5AR1/CD88 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg2185 Product name: Recombinant Human C5AR1/CD88 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-37 aa of NM_001736.4 Sequence: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPD Predict reactive species |
Full Name | complement component 5a receptor 1 |
Calculated Molecular Weight | 39kDa |
Observed Molecular Weight | 45 kDa |
GenBank Accession Number | NM_001736.4 |
Gene Symbol | C5aR |
Gene ID (NCBI) | 728 |
RRID | AB_3671877 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | P21730 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C5aR, also named CD88, is a G protein-coupled receptor for the anaphylatoxin C5a, a cleavage product of the complement cascade. The C5a ligand is a proinflammatory component of host defense. C5aR is activated upon binding of the C5a molecule. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release, and superoxide anion production. The deduced sequence of C5aR contains 350 amino acids, giving a calculated molecular weight of 39 kDa. C5aR has an N-linked glycosylation site in the N-terminal extracellular domain. The apparent molecular weight of C5aR is about 40-52 kDa (PMID: 1847994; 9136907; 9136907; 2007135).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for C5AR1/CD88 antibody 84336-6-RR | Download protocol |
IF protocol for C5AR1/CD88 antibody 84336-6-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |