Tested Applications
Positive WB detected in | COLO 320 cells, A549 cells, HepG2 cells |
Positive IHC detected in | human liver tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
22046-1-AP targets C5orf4 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16960 Product name: Recombinant human C5orf4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 224-333 aa of BC007216 Sequence: EHAVSNMLPVIVGPLVMGSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTDTMFKQTKAYERHVLLLGFTPLSESIPDSPKRME Predict reactive species |
Full Name | chromosome 5 open reading frame 4 |
Calculated Molecular Weight | 333 aa, 39 kDa |
Observed Molecular Weight | 40 kDa |
GenBank Accession Number | BC007216 |
Gene Symbol | C5orf4 |
Gene ID (NCBI) | 10826 |
RRID | AB_2878979 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96IV6 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Fatty acid hydroxylase domain containing 2 (FAXDC2), also known as C5orf4, is a 40 kDa protein. The function of FAXDC2 remains largely unknown. The MW of this protein is 25 kDa, and this antibody specially recognises the 25 kDa protein.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for C5orf4 antibody 22046-1-AP | Download protocol |
IHC protocol for C5orf4 antibody 22046-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Clin Invest The cholesterol biosynthesis enzyme FAXDC2 couples Wnt/β-catenin to RTK/MAPK signaling |