Complement C6 Polyclonal antibody, PBS Only

• 

  WB analysis of human blood using 17239-1-AP (same clone as 17239-1-PBS)

  human blood were subjected to SDS PAGE followed by western blot with 17239-1-AP (C6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17239-1-PBS in a different storage buffer formulation.

• 

  IP experiment of human plasma using 17239-1-AP (same clone as 17239-1-PBS)

  IP result of anti-Complement C6 (IP:17239-1-AP, 4ug; Detection:17239-1-AP 1:3000) with human plasma lysate 3200 ug. This data was developed using the same antibody clone with 17239-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 17239-1-AP (same clone as 17239-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 17239-1-AP (C6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17239-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 17239-1-AP (same clone as 17239-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 17239-1-AP (C6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17239-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 17239-1-AP (same clone as 17239-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17239-1-AP (C6 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17239-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 17239-1-AP (same clone as 17239-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17239-1-AP (C6 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17239-1-PBS in a different storage buffer formulation.

Complement C6 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 17239-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

C6, complement component 6, Complement component C6

---

Product Information

17239-1-PBS targets Complement C6 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11083

  Product name: Recombinant human C6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 586-934 aa of BC035723

  Sequence: TRECNNPAPQRGGKRCEGEKRQEEDCTFSIMENNGQPCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQLYLVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQRLYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQSGSECICMSPEEDCSHHSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDGRQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKMGSSTSEKTLNICEVGTIRCANRKMEILHPGKCLA

• Full Name: complement component 6
• Calculated Molecular Weight: 934 aa, 105 kDa
• Observed Molecular Weight: 105-120 kDa
• GenBank Accession Number: BC035723
• Gene Symbol: C6
• Gene ID (NCBI): 729
• RRID: AB_2878366
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13671
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The final consequence of complement activation is formation of the membrane attack complex (MAC), a multiprotein assembly that perforates cell membranes, forming transmembrane channels. C6 is 1 of 5 late-acting proteins of complement that participate in assembly and function of the MAC. The deduced C6 protein contains 934 amino acids, including a 21-amino acid N-terminal signal sequence and 2 N-glycosylation sites. Mutations in the C6 gene are associated with complement component-6 deficiency.