Tested Applications
| Positive IHC detected in | human placenta tissue, human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15076-1-AP targets C7orf49 in IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag7148 Product name: Recombinant human C7orf49 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC000168 Sequence: MKAPKRMRMAAVPVAAARLPATRTVYCMNEAEIVDVALGILIESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPEEEEEEDVLKYVREIFFS Predict reactive species | 
                                    
| Full Name | chromosome 7 open reading frame 49 | 
| Calculated Molecular Weight | 17 kDa | 
| GenBank Accession Number | BC000168 | 
| Gene Symbol | C7orf49 | 
| Gene ID (NCBI) | 78996 | 
| RRID | AB_2878107 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9BWK5 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
C7orf49, also named as MRI, may act as a regulator of proteasome.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for C7orf49 antibody 15076-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 







