C7orf49 Polyclonal antibody

• 

  IHC staining of human skin using 15076-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 15076-1-AP (C7orf49 Antibody) at dilution of 1:25 (under 10x lens).

• 

  IHC staining of human skin using 15076-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 15076-1-AP (C7orf49 Antibody) at dilution of 1:25 (under 40x lens).

• 

  IHC staining of human placenta using 15076-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 15076-1-AP (C7orf49 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin using 15076-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 15076-1-AP (C7orf49 Antibody) at dilution of 1:50 (under 40x lens).

C7orf49 Polyclonal Antibody for IHC, ELISA

Cat No. 15076-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

Cell cycle regulator of NHEJ, Cell cycle regulator of non-homologous end joining, CYREN, MRI

---

Tested Applications

• Positive IHC detected in: human placenta tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15076-1-AP targets C7orf49 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7148

  Product name: Recombinant human C7orf49 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-129 aa of BC000168

  Sequence: MKAPKRMRMAAVPVAAARLPATRTVYCMNEAEIVDVALGILIESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPEEEEEEDVLKYVREIFFS

• Full Name: chromosome 7 open reading frame 49
• Calculated Molecular Weight: 17 kDa
• GenBank Accession Number: BC000168
• Gene Symbol: C7orf49
• Gene ID (NCBI): 78996
• RRID: AB_2878107
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BWK5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C7orf49, also named as MRI, may act as a regulator of proteasome.