C8B Polyclonal antibody

• 

  WB analysis of human plasma using 25184-1-AP

  human plasma was subjected to SDS PAGE followed by western blot with 25184-1-AP (C8B antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 25184-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 25184-1-AP (C8B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 25184-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 25184-1-AP (C8B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

C8B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25184-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

---

Tested Applications

• Positive WB detected in: human plasma
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25184-1-AP targets C8B in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18388

  Product name: Recombinant human C8B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 242-591 aa of BC130575

  Sequence: RNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMVEDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

• Full Name: complement component 8, beta polypeptide
• Calculated Molecular Weight: 591 aa, 67 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC130575
• Gene Symbol: C8B
• Gene ID (NCBI): 732
• RRID: AB_3085774
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07358
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The beta chain of complement component 8 (C8B) is one of three different subunits (alpha, beta, and gamma) of the complement component 8 (C8), which is a component of the MAC (membrane attack complex). The deficiency of C8B leads to the type II of C8 deficiency, leading to the malfunction of MAC.