C8orf4 Polyclonal antibody

C8orf4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26279-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

hTC 1, TC 1, TC1, TC-1, TCIM

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of mouse kidney using 26279-1-AP
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 26279-1-AP (C8orf4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 26279-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 26279-1-AP (C8orf4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human thyroid cancer using 26279-1-AP
Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 26279-1-AP (C8orf4 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human thyroid cancer using 26279-1-AP
Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 26279-1-AP (C8orf4 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse stomach using 26279-1-AP
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 26279-1-AP (C8orf4 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 26279-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 26279-1-AP (C8orf4 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 26279-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 26279-1-AP (C8orf4 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 26279-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26279-1-AP (C8orf4 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 26279-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 26279-1-AP (C8orf4 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat stomach using 26279-1-AP
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 26279-1-AP (C8orf4 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 26279-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26279-1-AP (C8orf4 Antibody) at dilution of 1:200 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 26279-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26279-1-AP (C8orf4 Antibody) at dilution of 1:200 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for C8orf4 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse kidney tissue, HEK-293 cells
Positive IHC detected in	human thyroid cancer tissue, mouse kidney tissue, human kidney tissue, human ovary cancer tissue, mouse stomach tissue, rat stomach tissue, human placenta tissue, rat kidney tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:200-1:1000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26279-1-AP targets C8orf4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag23930 Product name: Recombinant human C8orf4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-106 aa of BC021672 Sequence: MKAKRSHQAIIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKAEERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH Predict reactive species
Full Name	chromosome 8 open reading frame 4
Observed Molecular Weight	14 kDa
GenBank Accession Number	BC021672
Gene Symbol	C8orf4
Gene ID (NCBI)	56892
RRID	AB_2880460
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NR00
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for C8orf4 antibody 26279-1-AP	Download protocol
WB protocol for C8orf4 antibody 26279-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The C8orf4 Polyclonal antibody (Cat# 26279-1-AP) has 1 total citation. It was cited in Medicine (Baltimore) in a 2023 study investigating the correlation between upregulated TC1 and downregulated Chibby with aberrant β-catenin expression in laryngeal squamous cell carcinoma. The application used was IHC on human samples. The associated research field is oncology, specifically head and neck cancer.

Species	Application	Title
human	IHC	Medicine (Baltimore) Upregulated TC1 and downregulated Chibby were correlated with the aberrant β-catenin expression in laryngeal squamous cell carcinoma Authors - Gang Ren View Article