Tested Applications
Positive WB detected in | mouse kidney tissue, HEK-293 cells |
Positive IHC detected in | human thyroid cancer tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IHC | See 1 publications below |
Product Information
26279-1-AP targets C8orf4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23930 Product name: Recombinant human C8orf4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-106 aa of BC021672 Sequence: MKAKRSHQAIIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKAEERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH Predict reactive species |
Full Name | chromosome 8 open reading frame 4 |
Observed Molecular Weight | 14 kDa |
GenBank Accession Number | BC021672 |
Gene Symbol | C8orf4 |
Gene ID (NCBI) | 56892 |
RRID | AB_2880460 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NR00 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for C8orf4 antibody 26279-1-AP | Download protocol |
IHC protocol for C8orf4 antibody 26279-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |