Carbonic Anhydrase 6/CA6 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Carbonic Anhydrase 6/CA6 Recombinant monoclonal antibody, PBS Only (Capture/Detector) (85940-2-PBS)

• 

  Sandwich ELISA sample test of MP02211-2

  Human milk of eight individual healthy human donors was measured. The Carbonic Anhydrase 6/CA6 concentration of detected samples was determined to be 3.9 μg/mL with a range of 0.7-13.7 μg/mL.

• 

  Sandwich ELISA sample test of MP02211-2

  Saliva of eight individual healthy human donors was measured. The Carbonic Anhydrase 6/CA6 concentration of detected samples was determined to be 5,869.5 ng/mL with a range of 1,531.8-9,760.2 ng/mL.

• 

  Sandwich ELISA sample test of MP02211-2

  Serum of eight individual healthy human donors was measured. The Carbonic Anhydrase 6/CA6 concentration of detected samples was determined to be 27.1 ng/mL with a range of 8.0-42.4 ng/mL.

• 

  Sandwich ELISA standard curve of MP02211-2

  Sandwich ELISA standard curve of MP02211-2, Human Carbonic Anhydrase 6/CA6 Recombinant Matched Antibody Pair - PBS only. 85940-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg2963. 85940-2-PBS was HRP conjugated as the detection antibody. Range: 31.3-2000 pg/mL.

• 

  Cytometric bead array sample test of MP02211-1

  The mean Carbonic Anhydrase 6/CA6 concentration was determined to be 71.8 ng/mL in human serum.

• 

  Cytometric bead array standard curve of MP02211-1

  Cytometric bead array standard curve of MP02211-1, Carbonic Anhydrase 6/CA6 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85940-2-PBS. Detection antibody: 85940-1-PBS. Standard: Eg2963. Range: 0.781-100 ng/mL.

Carbonic Anhydrase 6/CA6 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 85940-2-PBS

Clone No.250412E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

CA6, CA VI, Carbonate dehydratase VI, Carbonic anhydrase 6, CA-VI

---

Product Information

85940-2-PBS targets Carbonic Anhydrase 6/CA6 as part of a matched antibody pair:

MP02211-1: 85940-2-PBS capture and 85940-1-PBS detection (validated in Cytometric bead array)

MP02211-2: 85940-1-PBS capture and 85940-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2963

  Product name: Recombinant Human Carbonic Anhydrase 6/CA6 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 18-308 aa of NM_001215.3

  Sequence: QHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN

• Full Name: carbonic anhydrase VI
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: NM_001215.3
• Gene Symbol: CA6
• Gene ID (NCBI): 765
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23280-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.