Tested Applications
Positive WB detected in | HeLa cells, MCF-7 cells, C6 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
31710-1-AP targets CAB39 in WB, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag36153 Product name: Recombinant human CAB39 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC020570 Sequence: MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMK Predict reactive species |
Full Name | calcium binding protein 39 |
Observed Molecular Weight | 39-40 kDa |
GenBank Accession Number | BC020570 |
Gene Symbol | CAB39 |
Gene ID (NCBI) | 51719 |
RRID | AB_3670091 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity Purification |
UNIPROT ID | Q9Y376 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CAB39 (Calcium-binding protein 39), also called MO25, is a component of the complex that binds and activates STK11/LKB1. It is required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1 (PMID: 19892943).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CAB39 antibody 31710-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |