CAB39 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84760-4-RR (same clone as 84760-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84760-4-RR (CAB39 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84760-4-PBS in a different storage buffer formulation.

• 

  IF Staining of C6 using 84760-4-RR (same clone as 84760-4-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed C6 cells using CAB39 antibody (84760-4-RR, Clone: 242094G11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84760-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84760-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84760-4-RR against Human CAB39 were performed. The affinity constant is 0.304 nM.

CAB39 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 84760-4-PBS

Clone No.242094G11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

242094G11, calcium binding protein 39, CGI 66, MO25, Protein Mo25

---

Product Information

84760-4-PBS targets CAB39 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag36153

  Product name: Recombinant human CAB39 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-51 aa of BC020570

  Sequence: MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMK

• Full Name: calcium binding protein 39
• Observed Molecular Weight: 39-40 kDa
• GenBank Accession Number: BC020570
• Gene Symbol: CAB39
• Gene ID (NCBI): 51719
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9Y376
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CAB39 (Calcium-binding protein 39), also called MO25, is a component of the complex that binds and activates STK11/LKB1. It is required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1 (PMID: 19892943).