Product Information
84760-4-PBS targets CAB39 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag36153 Product name: Recombinant human CAB39 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC020570 Sequence: MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMK Predict reactive species |
Full Name | calcium binding protein 39 |
Observed Molecular Weight | 39-40 kDa |
GenBank Accession Number | BC020570 |
Gene Symbol | CAB39 |
Gene ID (NCBI) | 51719 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | Q9Y376 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
CAB39 (Calcium-binding protein 39), also called MO25, is a component of the complex that binds and activates STK11/LKB1. It is required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1 (PMID: 19892943).