CABC1 Polyclonal antibody

• 

  WB analysis using 15528-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15528-1-AP (CABC1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 15528-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15528-1-AP (CABC1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 15528-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15528-1-AP (CABC1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 15528-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 15528-1-AP (CABC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse heart using 15528-1-AP

  IP result of anti-CABC1 (IP:15528-1-AP, 4ug; Detection:15528-1-AP 1:300) with mouse heart tissue lysate 3700 ug.

• 

  IHC staining of human stomach using 15528-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal stomach slide using 15528-1-AP (CABC1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 15528-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 15528-1-AP (CABC1 antibody), at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Red: CL555-phalloidin staining of F-actin.

• Featured Product
• KD/KO Validated

CABC1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15528-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Chaperone activity of bc1 complex-like, Chaperone ABC1 like, Atypical kinase COQ8A, mitochondrial, ARCA2, ADCK3

---

Tested Applications

• Positive WB detected in: HeLa cells, human skeletal muscle tissue, human heart tissue, mouse heart tissue, U-251 cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below
• IHC: See 1 publications below

Product Information

15528-1-AP targets CABC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7612

  Product name: Recombinant human CABC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 300-647 aa of BC005171

  Sequence: VRQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAASIGQVHLARMKGGREVAMKIQYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELALECDYQREAACARKFRDLLKGHPFFYVPEIVDELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAKSIEMKFLTGYEVKVMEDAHLDAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLVPPPEETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ

• Full Name: chaperone, ABC1 activity of bc1 complex homolog (S. pombe)
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC005171
• Gene Symbol: CABC1
• Gene ID (NCBI): 56997
• RRID: AB_2066403
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NI60
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CABC1 (Chaperone, ABC1 activity of bc1 complex homolog) is induced by the tumor suppressor p53 and is similar to the yeast ABC1, which is involved in an electron-transferring membrane protein complex in the respiratory chain. The CABC1 product was located in mitochondria, and may play an important role in mediating p53-inducible apoptosis. Four isoforms of CABC1 exist due to alternative splicing events.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Drug Resist Updat; Upregulation of CoQ shifts ferroptosis dependence from GPX4 to FSP1 in acquired radioresistance; Authors - Xu Lin ; KD Validated
mouse	WB	EMBO Mol Med; β-RA reduces DMQ/CoQ ratio and rescues the encephalopathic phenotype in Coq9 R239X mice.; Authors - Agustín Hidalgo-Gutiérrez
human	WB	Cerebellum; Mitochondrial Dysfunction due to Novel COQ8A Variation with Poor Response to CoQ10 Treatment: A Comprehensive Study and Review of Literatures; Authors - Jiayin Wang
human	WB	Antiviral Res; Chromatin binding protein HMGN1 promotes HBV cccDNA transcription and replication by regulating the phosphorylation of histone 3; Authors - Tan Ming