CABC1 Polyclonal antibody, PBS Only

• 

  WB analysis using 15528-1-AP (same clone as 15528-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15528-1-AP (CABC1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15528-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 15528-1-AP (same clone as 15528-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15528-1-AP (CABC1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15528-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 15528-1-AP (same clone as 15528-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15528-1-AP (CABC1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15528-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 15528-1-AP (same clone as 15528-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 15528-1-AP (CABC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15528-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse heart using 15528-1-AP (same clone as 15528-1-PBS)

  IP result of anti-CABC1 (IP:15528-1-AP, 4ug; Detection:15528-1-AP 1:300) with mouse heart tissue lysate 3700 ug. This data was developed using the same antibody clone with 15528-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 15528-1-AP (same clone as 15528-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal stomach slide using 15528-1-AP (CABC1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15528-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 15528-1-AP (same clone as 15528-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 15528-1-AP (CABC1 antibody), at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Red: CL555-phalloidin staining of F-actin. This data was developed using the same antibody clone with 15528-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CABC1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 15528-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Chaperone activity of bc1 complex-like, Chaperone ABC1 like, Atypical kinase COQ8A, mitochondrial, ARCA2, ADCK3

---

Product Information

15528-1-PBS targets CABC1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7612

  Product name: Recombinant human CABC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 300-647 aa of BC005171

  Sequence: VRQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAASIGQVHLARMKGGREVAMKIQYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELALECDYQREAACARKFRDLLKGHPFFYVPEIVDELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLRELFEFHFMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAKSIEMKFLTGYEVKVMEDAHLDAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLVPPPEETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ

• Full Name: chaperone, ABC1 activity of bc1 complex homolog (S. pombe)
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC005171
• Gene Symbol: CABC1
• Gene ID (NCBI): 56997
• RRID: AB_2066403
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NI60
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CABC1 (Chaperone, ABC1 activity of bc1 complex homolog) is induced by the tumor suppressor p53 and is similar to the yeast ABC1, which is involved in an electron-transferring membrane protein complex in the respiratory chain. The CABC1 product was located in mitochondria, and may play an important role in mediating p53-inducible apoptosis. Four isoforms of CABC1 exist due to alternative splicing events.