CACHD1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83350-4-RR (same clone as 83350-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83350-4-RR (CACHD1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83350-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83350-4-PBS

  Biolayer interferometry (BLl) kinetic assays of 83350-4-RR against Human CACHD1 were performed. The affinity constant is 6.83 nM.

CACHD1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83350-4-PBS

Clone No.240197A2

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

VWCD1, RP4 655E10.1, KIAA1573, Cache domain-containing protein 1, cache domain containing 1

---

Product Information

83350-4-PBS targets CACHD1 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22138

  Product name: Recombinant human CACHD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-348 aa of BC039301

  Sequence: MSTFVSSVKSSDSPTQHAVGFQKAFQLIRSTNNNTKFQANTDMVIIYLSAGITSKDSSEEDKKATLQVINEENSFLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSGKYGVPDRTALPVIKGSMMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMGDGLIMTVSKPCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPYLLSEPPLHTDIIHYENIPKFELVRQNILSLPLGSQIIAVPVNSSLSWHINKLRETGKEAYNVSYAWKMVQDTSFILCIVVIQPEIPVKQLKNLNTVPSSKLLYHRLDLLGQPSACLHF

• Full Name: cache domain containing 1
• Calculated Molecular Weight: 1274 aa, 142 kDa
• GenBank Accession Number: BC039301
• Gene Symbol: CACHD1
• Gene ID (NCBI): 57685
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q5VU97
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CACHD1 (Cache domain-containing protein 1), also called VWCD1 (VWFA and cache domain-containing protein 1), is a type I membrane protein involved that modulates the activities of voltage-gated Ca(2+) channels (VGCCs) (PMID: 30181139; 30404013). CACHD1 has two isoforms, with molecular weights of 142 kDa and 109 kDa respectively. It has certain glycosylation modifications, and the molecular weight of isoform1 after glycosylation modification is 170 kDa (PMID: 30983497; 30404013). This antibody recognizes 142-170 kDa.