CACNA1G Polyclonal antibody, PBS Only

• 

  IHC staining of human cerebellum using 17821-1-AP (same clone as 17821-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 17821-1-AP (CACNA1G Antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17821-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cerebellum using 17821-1-AP (same clone as 17821-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 17821-1-AP (CACNA1G Antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17821-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 17821-1-AP (same clone as 17821-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 17821-1-AP (CACNA1G Antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17821-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 17821-1-AP (same clone as 17821-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 17821-1-AP (CACNA1G Antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17821-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 17821-1-AP (same clone as 17821-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CACNA1G antibody (17821-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17821-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 17821-1-AP (same clone as 17821-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using CACNA1G antibody (17821-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17821-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 17821-1-AP (same clone as 17821-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse cerebellum tissue using CACNA1G antibody (17821-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), FUS/TLS antibody (68262-1-Ig, Clone: 1B4F8, red). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17821-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart tissue using 17821-1-AP (same clone as 17821-1-PBS)

  IF result of anti-CACNA1G (17821-1-AP) in frozen mouse heart section by Dr Nicola Smart. This data was developed using the same antibody clone with 17821-1-PBS in a different storage buffer formulation.

CACNA1G Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 17821-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, Indirect ELISA

Synonyms

Ca(V)T.1, Cav3.1, Cav3.1c, KIAA1123, NBR13

---

Product Information

17821-1-PBS targets CACNA1G in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12188

  Product name: Recombinant human CACNA1G protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 396-742 aa of BC110995

  Sequence: TQFSETKQRESQLMREQRVRFLSNASTLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPSSSCSRSHRRLSVHHLVHHHHHHHHHYHLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTPALSGAPPGGAESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPETLKEKALVEVAASSGPPTLTSLNIPPGPYSSMHKLLETQSTGACQSSCKISSPCLKADSGACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQHSDLRDPHSRRQRSLGPDAEPSSVLAFWRLICDTFRKIVDS

• Full Name: calcium channel, voltage-dependent, T type, alpha 1G subunit
• Calculated Molecular Weight: 2261aa,250 kDa; 2377aa,263 kDa
• GenBank Accession Number: BC110995
• Gene Symbol: CACNA1G
• Gene ID (NCBI): 8913
• RRID: AB_2878446
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43497
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.