CACNA1G Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CACNA1G Polyclonal antibody (17821-1-AP)

CACNA1G Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 17821-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, ELISA

Synonyms

Ca(V)T.1, Cav3.1, Cav3.1c, KIAA1123, NBR13

• 

  IHC staining of human cerebellum using 17821-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 17821-1-AP (CACNA1G Antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cerebellum using 17821-1-AP

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 17821-1-AP (CACNA1G Antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 17821-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 17821-1-AP (CACNA1G Antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 17821-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 17821-1-AP (CACNA1G Antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 17821-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CACNA1G antibody (17821-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat brain using 17821-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using CACNA1G antibody (17821-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse cerebellum using 17821-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse cerebellum tissue using CACNA1G antibody (17821-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), FUS/TLS antibody (68262-1-Ig, Clone: 1B4F8, red). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse heart tissue using 17821-1-AP

  IF result of anti-CACNA1G (17821-1-AP) in frozen mouse heart section by Dr Nicola Smart.

Able AI

What's the best dilution for CACNA1G in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human cerebellum tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse cerebellum tissue, mouse brain tissue, rat brain tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17821-1-AP targets CACNA1G in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12188

  Product name: Recombinant human CACNA1G protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 396-742 aa of BC110995

  Sequence: TQFSETKQRESQLMREQRVRFLSNASTLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPSSSCSRSHRRLSVHHLVHHHHHHHHHYHLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTPALSGAPPGGAESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPETLKEKALVEVAASSGPPTLTSLNIPPGPYSSMHKLLETQSTGACQSSCKISSPCLKADSGACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQHSDLRDPHSRRQRSLGPDAEPSSVLAFWRLICDTFRKIVDS

• Full Name: calcium channel, voltage-dependent, T type, alpha 1G subunit
• Calculated Molecular Weight: 2261aa,250 kDa; 2377aa,263 kDa
• GenBank Accession Number: BC110995
• Gene Symbol: CACNA1G
• Gene ID (NCBI): 8913
• RRID: AB_2878446
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43497
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CACNA1G Polyclonal antibody (Cat# 17821-1-AP) has 6 citations published in Nature Methods, Oxidative Medicine and Cellular Longevity, iScience, Journal of Perinatal Medicine, bioRxiv, and Aging (Albany NY). The cited research spans neuroscience (neuronal connectivity mapping, hippocampal senescence), cardiology (sinoatrial node function, cardiac ion channels), perinatal medicine (stillbirth), and aging-related mechanisms. Applications in these studies include immunofluorescence and immunohistochemistry in mouse and human samples.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nat Methods; Connectome-seq: high-throughput mapping of neuronal connectivity at single-synapse resolution via barcode sequencing.; Authors - Danping Chen
mouse	IF	Oxid Med Cell Longev; NRF-2/HO-1 Pathway-Mediated SHOX2 Activation Is a Key Switch for Heart Rate Acceleration by Yixin-Fumai Granules; Authors - Heng Zhang
Mouse		iScience; IGF2BP2-Shox2 axis regulates hippocampal-neuronal senescence to alleviate microgravity-induced recognition disturbance; Authors - Yujie Zhao
human	IHC	J Perinat Med; Cardiac ion channels associated with unexplained stillbirth - An immunohistochemical study.; Authors - Susana Quesado Branco
mouse	IF	Aging (Albany NY); D-galactose causes sinoatrial node dysfunction: from phenotype to mechanism; Authors - Heng Zhang
mouse	IF	bioRxiv; Connectome-seq: High-throughput Mapping of Neuronal Connectivity at Single-Synapse Resolution via Barcode Sequencing.; Authors - Danping Chen