Tested Applications
Positive WB detected in | HEK-293 cells, mouse kidney tissue |
Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
Product Information
13729-1-AP targets CACNG3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4730 Product name: Recombinant human CACNG3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 202-315 aa of BC040005 Sequence: EKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV Predict reactive species |
Full Name | calcium channel, voltage-dependent, gamma subunit 3 |
Calculated Molecular Weight | 315 aa, 36 kDa |
Observed Molecular Weight | 40 kDa |
GenBank Accession Number | BC040005 |
Gene Symbol | CACNG3 |
Gene ID (NCBI) | 10368 |
RRID | AB_2070085 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O60359 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Voltage-dependent calcium channels couple membrane depolarization in a number of cellular processes. These activities are regulated by distinct channels composed of alpha-1, beta, alpha-2/delta, and gamma subunits. CACNG3, one of the eight gamma subunits in human, is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CACNG3 antibody 13729-1-AP | Download protocol |
IHC protocol for CACNG3 antibody 13729-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |