CALHM1 Polyclonal antibody

• 

  WB analysis of mouse brain using 22042-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22042-1-AP (CALHM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 22042-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 22042-1-AP (CALHM1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brain using 22042-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 22042-1-AP (CALHM1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 22042-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 22042-1-AP (CALHM1 antibody) at dilution of 1:50 (under 40x lens).

CALHM1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22042-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

CALHM1, FAM26C, Protein FAM26C

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

22042-1-AP targets CALHM1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14938

  Product name: Recombinant human CALHM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 235-346 aa of BC036193

  Sequence: CTEHAKAFAKVCIQQFFEAMNHDLELGHTNGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV

• Full Name: calcium homeostasis modulator 1
• Calculated Molecular Weight: 346 aa, 38 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC036193
• Gene Symbol: CALHM1
• Gene ID (NCBI): 255022
• RRID: AB_11182709
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IU99
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calcium homeostasis modulator 1 (CALHM1) is a membrane protein with four transmembrane helices that form an octameric ion channel with voltage-dependent activation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	IF	Pflugers Arch; Intracellular cAMP signaling-induced Ca2+ influx mediated by calcium homeostasis modulator 1 (CALHM1) in human odontoblasts; Authors - Maki Kimura
rat	IHC	J Oral Rehabil; Knockdown of the CALHM1 Gene Alleviates Allodynia in Rats With Trigeminal Neuralgia; Authors - Xiaolei Zhu