Tested Applications
Positive WB detected in | mouse brain tissue, rat brain tissue |
Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
22042-1-AP targets CALHM1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14938 Product name: Recombinant human CALHM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 235-346 aa of BC036193 Sequence: CTEHAKAFAKVCIQQFFEAMNHDLELGHTNGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV Predict reactive species |
Full Name | calcium homeostasis modulator 1 |
Calculated Molecular Weight | 346 aa, 38 kDa |
Observed Molecular Weight | 38-40 kDa |
GenBank Accession Number | BC036193 |
Gene Symbol | CALHM1 |
Gene ID (NCBI) | 255022 |
RRID | AB_11182709 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8IU99 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Calcium homeostasis modulator 1 (CALHM1) is a membrane protein with four transmembrane helices that form an octameric ion channel with voltage-dependent activation.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CALHM1 antibody 22042-1-AP | Download protocol |
IHC protocol for CALHM1 antibody 22042-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Pflugers Arch Intracellular cAMP signaling-induced Ca2+ influx mediated by calcium homeostasis modulator 1 (CALHM1) in human odontoblasts | ||
J Oral Rehabil Knockdown of the CALHM1 Gene Alleviates Allodynia in Rats With Trigeminal Neuralgia |