CALHM1 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 22042-1-AP (same clone as 22042-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22042-1-AP (CALHM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22042-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 22042-1-AP (same clone as 22042-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 22042-1-AP (CALHM1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22042-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 22042-1-AP (same clone as 22042-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 22042-1-AP (CALHM1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 22042-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 22042-1-AP (same clone as 22042-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 22042-1-AP (CALHM1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 22042-1-PBS in a different storage buffer formulation.

CALHM1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 22042-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

22042-1-PBS targets CALHM1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14938

  Product name: Recombinant human CALHM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 235-346 aa of BC036193

  Sequence: CTEHAKAFAKVCIQQFFEAMNHDLELGHTNGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGWAGGGPRPPRKEVATYFSKV

• Full Name: calcium homeostasis modulator 1
• Calculated Molecular Weight: 346 aa, 38 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC036193
• Gene Symbol: CALHM1
• Gene ID (NCBI): 255022
• RRID: AB_11182709
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IU99
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Calcium homeostasis modulator 1 (CALHM1) is a membrane protein with four transmembrane helices that form an octameric ion channel with voltage-dependent activation.