Product Information
10303-1-AP targets CALM1 in ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0490 Product name: Recombinant human CALM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-139 aa of BC000454 Sequence: FDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNY Predict reactive species |
Full Name | calmodulin 1 (phosphorylase kinase, delta) |
Calculated Molecular Weight | 17 kDa |
GenBank Accession Number | BC000454 |
Gene Symbol | CALM1 |
Gene ID (NCBI) | 801 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P0DP23 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |