Product Information
10303-1-AP targets CALM1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0490 Product name: Recombinant human CALM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-139 aa of BC000454 Sequence: FDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNY Predict reactive species |
| Full Name | calmodulin 1 (phosphorylase kinase, delta) |
| Calculated Molecular Weight | 17 kDa |
| GenBank Accession Number | BC000454 |
| Gene Symbol | CALM1 |
| Gene ID (NCBI) | 801 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P0DP23 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Fitoterapia Integrating LC-MS and molecular docking technology to investigate the effect of Spatholobi caulis flavonoids in alleviating primary dysmenorrhea via regulating the RhoA/ROCK pathway |
