Calmodulin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Calmodulin Polyclonal antibody (10541-1-AP)

Calmodulin Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 10541-1-AP Copied!

Publications (36)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, FC (Intra), IP, CoIP, ELISA

Synonyms

CALM3, CALML2, Calmodulin 1/2/3, Calmodulin 3, CaM

• 

  WB analysis using 10541-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10541-1-AP (Calmodulin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 10541-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10541-1-AP (Calmodulin antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 10541-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10541-1-AP (Calmodulin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 10541-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 10541-1-AP (Calmodulin antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10541-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10541-1-AP (Calmodulin antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NCCIT using 10541-1-AP

  NCCIT cell were subjected to SDS PAGE followed by western blot with 10541-1-AP (Calmodulin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Ramos using 10541-1-AP

  IP result of anti-Calmodulin (IP:10541-1-AP, 2ug; Detection:10541-1-AP 1:600) with Ramos cells lysate 1120 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10541-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10541-1-AP (Calmodulin antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10541-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10541-1-AP (Calmodulin antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 10541-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10541-1-AP (Calmodulin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 10541-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10541-1-AP (Calmodulin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of MCF-7 using 10541-1-AP

  1X10^6 MCF-7 cells were intracellularly stained with 0.4 ug Anti-Human Calmodulin (10541-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 10541-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human Calmodulin (10541-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Calmodulin in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, HepG2 cells, mouse brain tissue, MCF-7 cells, HeLa cells, NCCIT cells, rat skeletal muscle tissue
• Positive IP detected in: Ramos cells
• Positive IHC detected in: human breast cancer tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HeLa cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10541-1-AP targets Calmodulin in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0827

  Product name: Recombinant human CALM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC006182

  Sequence: MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDESLSMPLISSFCPRLFHPCLPRPDAFIS

• Full Name: calmodulin 3 (phosphorylase kinase, delta)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC006182
• Gene Symbol: Calmodulin 3
• Gene ID (NCBI): 808
• RRID: AB_2069442
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62158
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calmodulin (CaM) is a Ca(2+)-binding protein that transduces Ca2+-mediated signals by binding to and regulating the activity of hundreds of enzymes and non-enzymatic proteins. It is highly conserved across species and involved in many biological processes, including vesicle release, cell proliferation, and apoptosis. This antibody can recognize CALM1, CALM2 and CALM3.

Publications

What published studies show

The Calmodulin Polyclonal antibody (catalog number 10541-1-AP) has 36 citations. These appear in journals including Nature Communications, Cell Reports, Autophagy, Cancer Cell International, Frontiers in Immunology, Biochemical Pharmacology, European Journal of Pharmacology, International Journal of Molecular Sciences, Cell Signaling, iScience, Oncotarget, and others. Research fields span oncology (colorectal, esophageal, prostate, ovarian, liver cancers), neuroscience (synaptic function, alpha-synuclein, ischemia), cardiovascular disease (myocardial injury, atrial fibrillation), metabolism, fibrosis, preeclampsia, and calcium signaling pathways.

Automatically generated from the 36 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Autophagy; Periplocin suppresses the growth of colorectal cancer cells by triggering LGALS3 (galectin 3)-mediated lysophagy; Authors - Kui Wang
human	WB	Nat Commun; Stalled translation by mitochondrial stress upregulates a CNOT4-ZNF598 ribosomal quality control pathway important for tissue homeostasis; Authors - Ji Geng
human	WB	Nat Commun; Selectively targeting the AdipoR2-CaM-CaMKII-NOS3 axis by SCM-198 as a rapid-acting therapy for advanced acute liver failure; Authors - Rui Wang
mouse	WB	Phytomedicine; Astragaloside IV alleviates post-traumatic cytotoxic edema via inhibition of AQP4 expression and subcellular localization.; Authors - Weiqi Shen
rat	WB	Burns Trauma; Negative pressure-induced fibroblast activation for wound healing through the Piezo1-Ca(2+)-NFAT3 signaling pathway.; Authors - Shu-Ao Xiao
mouse	IHC	Int J Biol Macromol; Water-insoluble dietary fiber from walnut relieves constipation through Limosilactobacillus reuteri-mediated serotonergic synapse and neuroactive ligand-receptor pathways; Authors - Weixing Yang