Tested Applications
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28090-1-AP targets CAMK2N2 in IHC, ELISA applications and shows reactivity with Human, mouse samples.
| Tested Reactivity | Human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26872 Product name: Recombinant human CAMK2N2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC105077 Sequence: MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPSGV Predict reactive species |
| Full Name | calcium/calmodulin-dependent protein kinase II inhibitor 2 |
| GenBank Accession Number | BC105077 |
| Gene Symbol | CAMK2N2 |
| Gene ID (NCBI) | 94032 |
| RRID | AB_3086027 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96S95 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Calcium/calmodulin-dependent protein kinase II (CaMKII) is a key synaptic signaling molecule that regulates numerous physiological functions. CaMK2N2, also known as CAMKIIN, is one of the endogenous inhibitors of CaMKII. CaMK2N2 plays an important role in the regulation of cell growth (PMID: 11444830).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CAMK2N2 antibody 28090-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



