CARS2 Polyclonal antibody

• 

  WB analysis of SK-BR-3 using 33597-1-AP

  WB result of CARS2 antibody (33597-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CARS2 transfected SK-BR-3 cells.

• 

  IP experiment of SK-BR-3 using 33597-1-AP

  IP result of anti-CARS2 (IP:33597-1-AP, 4ug; Detection:33597-1-AP 1:3000) with SK-BR-3 cells lysate 1600 ug.

• 

  IF Staining of A431 using 33597-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CARS2 antibody (33597-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

CARS2 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 33597-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, ELISA

Synonyms

CysRS, Cysteinyl-tRNA synthetase, EC:6.1.1.16, OK/SW-cl.10, Probable cysteine--tRNA ligase, mitochondrial

---

Tested Applications

• Positive WB detected in: SK-BR-3 cells
• Positive IP detected in: SK-BR-3 cells
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33597-1-AP targets CARS2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38943

  Product name: Recombinant human CARS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 331-564 aa of NM_024537.3

  Sequence: FLKTFSPDVFRFFCLRSSYRSAIDYSDSAMLQAQQLLLGLGSFLEDARAYMKGQLACGSVREAMLWERLSSTKRAVKAALADDFDTPRVVDAILGLAHHGNGQLRASLKEPEGPRSPAVFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQRTKDQKSAG

• Full Name: cysteinyl-tRNA synthetase 2, mitochondrial (putative)
• Calculated Molecular Weight: 62kDa，564aa
• Observed Molecular Weight: 55-63kd
• GenBank Accession Number: NM_024537.3
• Gene Symbol: CARS2
• Gene ID (NCBI): 79587
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9HA77
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cars2 (mitochondrial cysteine-tRNA synthetase 2) is a class I aminoacyl-tRNA synthetase encoded by nuclear gene, which locates in mitochondria. Its core function is to catalyze cysteine to bind to corresponding trna, and ensure the translation of mitochondrial protein. Its mutation will cause diseases related to mitochondrial dysfunction.