Tested Applications
| Positive IP detected in | LNCaP cells |
| Positive IHC detected in | human breast cancer tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
34104-1-AP targets CASD1 in IHC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag41108 Product name: Recombinant human CASD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 109-227 aa of BC063284 Sequence: PQFKEEGNKHENIPFEDKTASVKVDFLWHPEVNGSMKQCIKVWTEDSIAKPHVIVAGAATWSIKIHNGSSEALSQYKMNITSIAPLLEKLAKTSDVYWVLQDPVYEDLLSENRKMITNE Predict reactive species |
| Full Name | CAS1 domain containing 1 |
| Observed Molecular Weight | 92 kDa |
| GenBank Accession Number | BC063284 |
| Gene Symbol | CASD1 |
| Gene ID (NCBI) | 64921 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q96PB1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CASD1 (CAS1 domain-containing 1) is a multi-pass transmembrane protein localized in the trans-Golgi network. It contains an N-terminal SGNH hydrolase domain and a C-terminal region with 15 transmembrane segments. CASD1 catalyzes the O-acetylation of the C9 position of CMP-sialic acid, generating the 9-O-acetylated CMP-sialic acid donor, which is subsequently used for the synthesis of O-acetylated gangliosides (e.g., 9-O-AcGD3). This modification shields sialic acid from recognition by viral receptors, participates in host-pathogen interactions, and regulates the pro-apoptotic activity of GD3. (PMID: 34208013)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CASD1 antibody 34104-1-AP | Download protocol |
| IP protocol for CASD1 antibody 34104-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





