Caspase 3/P17/P19 Monoclonal antibody

• 

  WB analysis of Jurkat using 66470-1-Ig

  Untreated and Staurosporine treated Jurkat cells were subjected to SDS PAGE followed by western blot with 66470-1-Ig (CASP3(human specific) antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66470-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66470-1-Ig (CASP3(human specific) antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 66470-1-Ig

  Untreated and staurosporine treated Jurkat cells were subjected to SDS PAGE followed by western blot with 66470-1-Ig (CASP3(human specific) antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 66470-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66470-1-Ig (CASP3(human specific) antibody at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66470-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66470-1-Ig (CASP3(human specific) antibody at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 66470-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 66470-1-Ig (Caspase 3(human specific) antibody) at dilution of 1:100 and CoraLite488-Conjugated Goat Anti-Mouse IgG(H+L).

Caspase 3(human specific) Monoclonal Antibody for WB, IF, IHC, ELISA

Cat No. 66470-1-Ig

Clone No.1E7F9

Publications(75)

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (6)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Apopain, CASP 3, CASP3, Caspase 3, Caspase3, CPP 32, CPP32, CPP32B, Cysteine protease CPP32, Protein Yama, SCA 1, SREBP cleavage activity 1

---

Tested Applications

• Positive WB detected in: Jurkat cells, HEK-293 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 69 publications below
• IHC: See 2 publications below
• IF: See 5 publications below

Product Information

66470-1-Ig targets Caspase 3(human specific) in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, pig, zebrafish, sheep, cow
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25029

  Product name: Recombinant human CASP3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 31-176 aa of BC016926

  Sequence: ISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDS

• Full Name: caspase 3, apoptosis-related cysteine peptidase
• Calculated Molecular Weight: 277 aa, 32 kDa
• Observed Molecular Weight: 32-35 kDa, 19 kDa, 17 kDa
• GenBank Accession Number: BC016926
• Gene Symbol: Caspase 3
• Gene ID (NCBI): 836
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P42574
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Casp3 (caspase 3), also named as CPP32, SCA-1 and Apopain, belongs to the peptidase C14A family. Caspase 3 is involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Caspase 3 cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. CASP3 is involved in the cleavage of huntingtin. This antibody is specific for human caspase 3, it can recognize the 32 kDa pro-caspase 3 as well as 17 and 19 kDa cleaved-caspase 3.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Adv; The deacetylation-phosphorylation regulation of SIRT2-SMC1A axis as a mechanism of antimitotic catastrophe in early tumorigenesis.; Authors - Fei Yi
rat	WB	Redox Biol; Restoration of L-OPA1 alleviates acute ischemic stroke injury in rats via inhibiting neuronal apoptosis and preserving mitochondrial function.; Authors - Yongxing Lai
human	WB	Environ Int; Chemical conjugation of FITC to track silica nanoparticles in vivo and in vitro: An emerging method to assess the reproductive toxicity of industrial nanomaterials.; Authors - Junxia Li
human	WB	Cancer Lett; UM-6 induces autophagy and apoptosis via the Hippo-YAP signaling pathway in cervical cancer.; Authors - Dongying Wang
rat	WB,IHC	Oxid Med Cell Longev; Gastrodin Promotes the Survival of Random-Pattern Skin Flaps via Autophagy Flux Stimulation.; Authors - Hongyu Chen
human	WB	Oxid Med Cell Longev; Farrerol Enhances Nrf2-Mediated Defense Mechanisms against Hydrogen Peroxide-Induced Oxidative Damage in Human Retinal Pigment Epithelial Cells by Activating Akt and MAPK.; Authors - Ning Ma