Caspase 3/P17/P19 Monoclonal antibody

Caspase 3(human specific) Monoclonal Antibody for WB, IF, IHC, ELISA
Cat No. 66470-1-Ig
Clone No.1E7F9

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (6)

Applications

WB, IHC, IF/ICC, ELISA

Apopain, CASP 3, CASP3, Caspase 3, Caspase3, CPP 32, CPP32, CPP32B, Cysteine protease CPP32, Protein Yama, SCA 1, SREBP cleavage activity 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HEK-293 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66470-1-Ig targets Caspase 3(human specific) in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, pig, zebrafish, sheep, cow
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25029

Product name: Recombinant human CASP3 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 31-176 aa of BC016926

Sequence: ISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDS

Predict reactive species
Full Name caspase 3, apoptosis-related cysteine peptidase
Calculated Molecular Weight 277 aa, 32 kDa
Observed Molecular Weight 32-35 kDa, 19 kDa, 17 kDa
GenBank Accession NumberBC016926
Gene Symbol Caspase 3
Gene ID (NCBI) 836
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42574
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Casp3 (caspase 3), also named as CPP32, SCA-1 and Apopain, belongs to the peptidase C14A family. Caspase 3 is involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Caspase 3 cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. CASP3 is involved in the cleavage of huntingtin. This antibody is specific for human caspase 3, it can recognize the 32 kDa pro-caspase 3 as well as 17 and 19 kDa cleaved-caspase 3.

Publications

SpeciesApplicationTitle
humanWB

Sci Adv

The deacetylation-phosphorylation regulation of SIRT2-SMC1A axis as a mechanism of antimitotic catastrophe in early tumorigenesis.

Authors - Fei Yi
ratWB

Redox Biol

Restoration of L-OPA1 alleviates acute ischemic stroke injury in rats via inhibiting neuronal apoptosis and preserving mitochondrial function.

Authors - Yongxing Lai
humanWB

Environ Int

Chemical conjugation of FITC to track silica nanoparticles in vivo and in vitro: An emerging method to assess the reproductive toxicity of industrial nanomaterials.

Authors - Junxia Li
humanWB

Cancer Lett

UM-6 induces autophagy and apoptosis via the Hippo-YAP signaling pathway in cervical cancer.

Authors - Dongying Wang
ratWB,IHC

Oxid Med Cell Longev

Gastrodin Promotes the Survival of Random-Pattern Skin Flaps via Autophagy Flux Stimulation.

Authors - Hongyu Chen
humanWB

Oxid Med Cell Longev

Farrerol Enhances Nrf2-Mediated Defense Mechanisms against Hydrogen Peroxide-Induced Oxidative Damage in Human Retinal Pigment Epithelial Cells by Activating Akt and MAPK.

Authors - Ning Ma
Loading...
||
New chat

Able

正在加载,请稍候...