• Featured Product
  • KD/KO Validated

Caspase 6/P18/P11 Polyclonal antibody

Caspase 6/P18/P11 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10198-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

CASP6, Caspase6, Apoptotic protease Mch 2, Apoptotic protease Mch-2, CASP 6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inStaurosporine treated Jurkat cells, mouse brain tissue, Jurkat cells
Positive IHC detected inhuman lung cancer tissue, human prostate cancer tissue, human skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10198-1-AP targets Caspase 6/P18/P11 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0257

Product name: Recombinant human Caspase 6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 59-222 aa of BC000305

Sequence: LTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRET

Predict reactive species
Full Name caspase 6, apoptosis-related cysteine peptidase
Calculated Molecular Weight 33 kDa, 22 kDa
Observed Molecular Weight 33-35 kDa
GenBank Accession NumberBC000305
Gene Symbol Caspase 6
Gene ID (NCBI) 839
RRIDAB_2259380
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP55212
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Caspase-6 belongs to caspase family of cysteinyl-aspartate specific proteases.Precursor of CASP6 produces two subunits, large (18kDa) and small (16kDa) that dimerize. It cleaves poly(ADP-ribose) polymerase, as well as lamins and is involved in the activation cascade of caspases responsible for apoptosis execution. Researches showed that CASP6 could be an early instigator of neuronal dysfunction and regulates B cell activation and differentiation into plasma cells by modifying cell cycle entry. IRAK3 is an important target for CASP6. It can reveal five bands of 28, 32, 36, 49, and 64 kDa in human neurons and fetal brain in western blot, the 32 and 28 kDa bands represent procaspase-6 and pro-arm caspase-6. Procaspase-6 is more abundant than pro-arm caspase-6 in adult tissue, whereas pro-arm caspase-6 is more abundant than pro-caspase-6 in fetal brain and cultured neurons. The higher molecular mass bands at 49 and 64 kDa likely represent dimers of p28 and p32.(PMID:10438520). In rat testis, it can be detected two bands of 34 kDa and 12 kDa or 14 kDa(PMID:12538628).

Protocols

Product Specific Protocols
IHC protocol for Caspase 6/P18/P11 antibody 10198-1-APDownload protocol
WB protocol for Caspase 6/P18/P11 antibody 10198-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB,IF

J Pharm Anal

Cornus officinalis with high pressure wine steaming enhanced anti-hepatic fibrosis: Possible through SIRT3-AMPK axis

Authors - Xin Han
mouseWB

Transl Stroke Res

Melatonin Offers Dual-Phase Protection to Brain Vessel Endothelial Cells in Prolonged Cerebral Ischemia-Recanalization Through Ameliorating ER Stress and Resolving Refractory Stress Granule

Authors - Danli Lu
humanWB

Chem Biol Interact

O-Alkylated derivatives of quercetin induce apoptosis of MCF-7 cells via a caspase-independent mitochondrial pathway.

Authors - Han Liao
humanWB

Biotechnol Bioeng

Generation of apoptosis-resistant HEK293 cells with CRISPR/Cas mediated quadruple gene knockout for improved protein and virus production.

Authors - Weifeng Zhang
  • KO Validated
humanWB

Front Microbiol

Enterovirus 71 Induces INF2 Cleavage via Activated Caspase-2 in Infected RD Cells.

Authors - Bei Wang
humanWB

Front Pharmacol

Astragalin Inhibits the Proliferation and Migration of Human Colon Cancer HCT116 Cells by Regulating the NF-κB Signaling Pathway.

Authors - Min Yang
Loading...
||
New chat

Able

正在加载,请稍候...