• Featured Product
  • KD/KO Validated

CBX5 Recombinant monoclonal antibody, PBS Only (Detector)

CBX5 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83258-5-PBS
Clone No.240145F11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

240145F11, Antigen p25, HP1, HP1 alpha, HP1A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83258-5-PBS targets CBX5 as part of a matched antibody pair:

MP00181-3: 83258-2-PBS capture and 83258-5-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34810

Product name: Recombinant human CBX5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 60-120 aa of BC006821

Sequence: PELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERG

Predict reactive species
Full Name chromobox homolog 5 (HP1 alpha homolog, Drosophila)
Calculated Molecular Weight 191 aa, 22 kDa
Observed Molecular Weight22 kDa
GenBank Accession NumberBC006821
Gene Symbol CBX5
Gene ID (NCBI) 23468
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP45973
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Chromobox protein homolog 5 (CBX5), also named heterochromatin protein 1 alpha (HP1a), is a highly conserved nonhistone protein involved in heterochromatin formation and gene silencing in different species including humans.HP1a is a Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). It may interact with lamin-Breceptor. HP1a is involved in the formation of functional kinetochore through interaction with MIS12complex proteins. Phosphorylation of HP1 and LBR during interphase mitosis may be responsible for some of the alterations in chromatin organization and nuclear structure which occur at various times during the cell cycle.The HP1a was expressed in nucleus and associates specifically with chromatin during metaphase and anaphase.Recent studies have shown that HP1a is present at many euchromatic sites and positively regulates euchromatic gene expression through RNA transcript association and interaction with hnRNPs in Drosophila (19798443).

Loading...
||
New chat Able
正在加载,请稍候...