Tested Applications
Positive WB detected in | HeLa cells, mouse brain tissue, rat brain tissue, HepG2 cells |
Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:12000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 30 publications below |
IHC | See 1 publications below |
IF | See 2 publications below |
IP | See 1 publications below |
Product Information
26312-1-AP targets MCU/CCDC109A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24733 Product name: Recombinant human CCDC109A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 155-233 aa of BC034235 Sequence: DLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTT Predict reactive species |
Full Name | coiled-coil domain containing 109A |
Calculated Molecular Weight | 35 kDa |
Observed Molecular Weight | 30-35 kDa |
GenBank Accession Number | BC034235 |
Gene Symbol | CCDC109A |
Gene ID (NCBI) | 90550 |
RRID | AB_2880474 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8NE86 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MCU, also known as CCDC109A, is highly conserved across all eukaryotes. The MCU protein is composed of two coiled-coil domains, two TMDs, and a short motif of amino acids between the two TMDs. Knockdown of MCU dramatically reduces mitochondrial Ca2+ uptake in isolated mitochondria, in permeabilized cells and living cells. MCU has 3 isoforms with MW 40,37 and 35 kDa (refer to UniProt). The observed MW of MCU is mainly between 30 to 35 kDa in paper (PMID: 26341627; 28337252).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MCU/CCDC109A antibody 26312-1-AP | Download protocol |
IHC protocol for MCU/CCDC109A antibody 26312-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Death Differ Ca2+-mediated mitochondrial inner membrane permeabilization induces cell death independently of Bax and Bak. | ||
Environ Pollut TDCPP and TiO2 NPs aggregates synergistically induce SH-SY5Y cell neurotoxicity by excessive mitochondrial fission and mitophagy inhibition | ||
Cell Rep A mitochondrial inside-out iron-calcium signal reveals drug targets for Parkinson's disease | ||
Int J Mol Sci Effects of MICU1-Mediated Mitochondrial Calcium Uptake on Energy Metabolism and Quality of Vitrified-Thawed Mouse Metaphase II Oocytes | ||
J Agric Food Chem Puerarin Ameliorated PCOS through Preventing Mitochondrial Dysfunction Dependent on the Maintenance of Intracellular Calcium Homeostasis | ||
iScience Matrix stiffness aggravates osteoarthritis progression through H3K27me3 demethylation induced by mitochondrial damage |