Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CCDC111/PRIMPOL Polyclonal antibody

CCDC111/PRIMPOL Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29824-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

CCDC111, PRIMPOL, Coiled-coil domain-containing protein 111, EC:2.7.7.102, hPrimpol1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HEK-293 cells, HepG2 cells, HeLa cells, Jurkat cells
Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29824-1-AP targets CCDC111/PRIMPOL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31478

Product name: Recombinant human CCDC111 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 305-560 aa of BC064600

Sequence: EVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFSDTLRILTCEPSQNKQKGVGYFNSIGTSVETIEGFQCSPYPEVDHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEVWYQKCHDPVCKAENFKSDCFPLPAEVCLLFLFKEEEEFTTDEADETRSNETQNPHKPSPSRLSTGASADAVWDNGIDDAYFLEATEDAELAEAAENSLLSYNSEVDEIPDELIIEVLQE

Predict reactive species
Full Name coiled-coil domain containing 111
Observed Molecular Weight64 kDa
GenBank Accession NumberBC064600
Gene Symbol CCDC111/PRIMPOL
Gene ID (NCBI) 201973
RRIDAB_2918349
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96LW4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCDC111, also known as PRIMPOL, FLJ33167, which contains the active-site motifs of AEP primases and a putative Zn finger similar to that of herpesvirus UL52 primase and other AEP-like enzymes. CCDC111 is required to facilitate mitochondrial and nuclear replication fork progression by initiating de novo DNA synthesis using dNTPs and acting as an error-prone DNA polymerase able to bypass certain DNA lesions (PMID: 24126761, PMID: 24207056). In addition to its role in DNA damage response, also required to maintain efficient nuclear and mitochondrial DNA replication in unperturbed cells (Uniprot, PMID: 30715459).

Protocols

Product Specific Protocols
IF protocol for CCDC111/PRIMPOL antibody 29824-1-APDownload protocol
IHC protocol for CCDC111/PRIMPOL antibody 29824-1-APDownload protocol
WB protocol for CCDC111/PRIMPOL antibody 29824-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Nature

CFAP20 salvages arrested RNAPII from the path of co-directional replisomes

Authors - Sidrit Uruci
humanWB

Nat Cell Biol

RPA exhaustion activates SLFN11 to eliminate cells with heightened replication stress

Authors - Tyler H Stanage
humanWB

Nat Commun

The nuclease EXO1 promotes genomic instability by degrading nascent DNA in BRCA-proficient cells.

Authors - Alexandra Nusawardhana

Nat Commun

Multi-step processing of replication stress-derived nascent strand DNA gaps by MRE11 and EXO1 nucleases

Authors - Anastasia Hale

Nat Commun

Topological stress regulates replication fork dynamics in unperturbed S phase.

Authors - Deepika Jayaprakash
humanIF

Nat Commun

SLFN11 counteracts the RFWD3-PRIMPOL DNA damage tolerance axis to restrain gapped DNA synthesis in response to replication stress.

Authors - Kate E. Coleman

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Zubair (Verified Customer) (11-06-2025)

It Works fine

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: 293T

Hasan (Verified Customer) (01-31-2023)

WB analysis of PrimPol in whole lysate of different clones of HeLa cells. Blocking was done for 1h at room temperature with 5% skimmed milk. The primary Ab was used with 1:2000 dilution overnight at 4 degrees.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HeLa cells/ different clones
CCDC111/PRIMPOL Antibody Western Blot validation (1:2000 dilution) in HeLa cells/ different clones (Cat no:29824-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...