CCDC111/PRIMPOL Polyclonal antibody

• 

  WB analysis using 29824-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29824-1-AP (CCDC111/PRIMPOL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 29824-1-AP

  WB result of CCDC111/PRIMPOL antibody (29824-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CCDC111/PRIMPOL transfected HepG2 cells.

• 

  WB analysis using 29824-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29824-1-AP (CCDC111/PRIMPOL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 29824-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 29824-1-AP (CCDC111/PRIMPOL antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 29824-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using CCDC111/PRIMPOL antibody (29824-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

CCDC111/PRIMPOL Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29824-1-AP

Publications(18)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CCDC111, FLJ33167, hPrimpol1, PRIMPOL

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells, HepG2 cells, HeLa cells, Jurkat cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 15 publications below
• IF: See 1 publications below

Product Information

29824-1-AP targets CCDC111/PRIMPOL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31478

  Product name: Recombinant human CCDC111 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 305-560 aa of BC064600

  Sequence: EVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFSDTLRILTCEPSQNKQKGVGYFNSIGTSVETIEGFQCSPYPEVDHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCENIGRAHKSNNIMILVDLKNEVWYQKCHDPVCKAENFKSDCFPLPAEVCLLFLFKEEEEFTTDEADETRSNETQNPHKPSPSRLSTGASADAVWDNGIDDAYFLEATEDAELAEAAENSLLSYNSEVDEIPDELIIEVLQE

• Full Name: coiled-coil domain containing 111
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC064600
• Gene Symbol: CCDC111/PRIMPOL
• Gene ID (NCBI): 201973
• RRID: AB_2918349
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96LW4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCDC111, also known as PRIMPOL, FLJ33167, which contains the active-site motifs of AEP primases and a putative Zn finger similar to that of herpesvirus UL52 primase and other AEP-like enzymes. CCDC111 is required to facilitate mitochondrial and nuclear replication fork progression by initiating de novo DNA synthesis using dNTPs and acting as an error-prone DNA polymerase able to bypass certain DNA lesions (PMID: 24126761, PMID: 24207056). In addition to its role in DNA damage response, also required to maintain efficient nuclear and mitochondrial DNA replication in unperturbed cells (Uniprot, PMID: 30715459).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; An ATR-PrimPol pathway confers tolerance to oncogenic KRAS-induced and heterochromatin-associated replication stress; Authors - Taichi Igarashi
		Nat Commun; Multi-step processing of replication stress-derived nascent strand DNA gaps by MRE11 and EXO1 nucleases; Authors - Anastasia Hale
human	WB	Int J Mol Sci; CSB Regulates Pathway Choice in Response to DNA Replication Stress Induced by Camptothecin; Authors - Nicole L Batenburg
human	WB	bioRxiv; CRISPR knockout genome-wide screens identify the HELQ-RAD52 axis in regulating the repair of cisplatin-induced single stranded DNA gaps; Authors - Lindsey M Pale
human	WB	Nucleic Acids Res; USP1-dependent nucleolytic expansion of PRIMPOL-generated nascent DNA strand discontinuities during replication stress; Authors - Alexandra Nusawardhana
human	WB	Cell Rep; FANCM promotes PARP inhibitor resistance by minimizing ssDNA gap formation and counteracting resection inhibition; Authors - Zeyuan Liu ; KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hasan (Verified Customer) (01-31-2023)

WB analysis of PrimPol in whole lysate of different clones of HeLa cells. Blocking was done for 1h at room temperature with 5% skimmed milk. The primary Ab was used with 1:2000 dilution overnight at 4 degrees.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: HeLa cells/ different clones

CCDC111/PRIMPOL Antibody Western Blot validation (1:2000 dilution) in HeLa cells/ different clones (Cat no:29824-1-AP)