CCDC134 Polyclonal antibody

• 

  WB analysis using 26500-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26500-1-AP (CCDC134 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

CCDC134 Polyclonal Antibody for WB, ELISA

Cat No. 26500-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, hamster

Applications

WB, ELISA

Synonyms

CCDC134

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells, CHO cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26500-1-AP targets CCDC134 in WB, ELISA applications and shows reactivity with human, hamster samples.

• Tested Reactivity: human, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21990

  Product name: Recombinant human CCDC134 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-229 aa of BC017693

  Sequence: TLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSEL

• Full Name: coiled-coil domain containing 134
• Calculated Molecular Weight: 229 aa, 27 kDa
• Observed Molecular Weight: 27 kda
• GenBank Accession Number: BC017693
• Gene Symbol: CCDC134
• Gene ID (NCBI): 79879
• RRID: AB_3669541
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6E4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCDC134 (coiled-coil domain containing 134) encodes a secretory protein that can inhibit the MAPK pathway as a novel human MAPK-regulating protein (PMID: 18087676). CCDC134 is in extracellular secreted form, promotes proliferation and activation of CD8(+) T cells, suggesting a cytokine-like function (PubMed: 25125657). CCDC134 is widely expressed in normal adult tissues, tumor tissues and cell lines with the molecular weight of 27 kDa.